KEGG   Pseudovibrio sp. FO-BEG1: PSE_4415Help
Entry
PSE_4415          CDS       T01669                                 

Gene name
tdk
Definition
(GenBank) Thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
psf  Pseudovibrio sp. FO-BEG1
Pathway
psf00240  Pyrimidine metabolism
psf01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:psf00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    PSE_4415 (tdk)
Enzymes [BR:psf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     PSE_4415 (tdk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK AAA_22 AAA_14 Big_3_3 AAA_30 DUF2075
Motif
Other DBs
NCBI-ProteinID: AEV38917
UniProt: G8PGG2
LinkDB All DBs
Position
4776115..4776750
Genome map
AA seq 211 aa AA seqDB search
MAKLYFNFSAMNAGKSTLLLQASYNYQERGMRSLLFTAALDNRTKVGEISSRIGLKSDAL
IYDTELDLFACIEEQLKEQQINAVFIDEAQFLTEEQVWQLARVADHLRIPVMAYGLRTDF
QGKMFPGSAALLAIADILREVRTICWCGSKATMVARMDESGNIVEEGDQVVIGGEESYIS
LCRKHWSMRKLGEPTENKDALADILCEPVDH
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaactatatttcaatttctccgcaatgaatgctggtaagtccactctgctgctg
caggcctcctacaactatcaggaacgtggcatgcgcagcctgctgttcacagcagcactc
gacaaccgcaccaaggtcggagaaatctcgtcgcgtattggcctcaaatcagacgctctg
atctacgacaccgaactcgatctgttcgcctgcatcgaagagcagctcaaagagcagcaa
atcaacgccgtctttatcgacgaagcgcagttcctgacggaagagcaggtctggcagctc
gcccgtgttgctgatcacctccgcattcctgtgatggcatatggccttagaaccgatttc
cagggcaagatgttcccaggcagtgccgcgcttcttgcaatcgcagacatccttcgcgaa
gtcagaaccatatgctggtgcggctctaaagcaaccatggtggcgcgtatggatgagagc
ggcaacattgttgaagaaggcgaccaggttgtcatcggcggtgaggaatcctacatctcg
ctctgcagaaaacattggtccatgcgcaaacttggcgagccaactgaaaacaaggatgcg
ctcgcagacatcctgtgcgaacctgtagaccactga

DBGET integrated database retrieval system