KEGG   Pseudovibrio sp. FO-BEG1: PSE_5033Help
Entry
PSE_5033          CDS       T01669                                 

Gene name
gadA
Definition
(GenBank) Glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
psf  Pseudovibrio sp. FO-BEG1
Pathway
psf00250  Alanine, aspartate and glutamate metabolism
psf00410  beta-Alanine metabolism
psf00430  Taurine and hypotaurine metabolism
psf00650  Butanoate metabolism
psf01100  Metabolic pathways
psf01110  Biosynthesis of secondary metabolites
psf01120  Microbial metabolism in diverse environments
psf02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:psf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    PSE_5033 (gadA)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    PSE_5033 (gadA)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    PSE_5033 (gadA)
   00430 Taurine and hypotaurine metabolism
    PSE_5033 (gadA)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    PSE_5033 (gadA)
Enzymes [BR:psf01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     PSE_5033 (gadA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5
Motif
Other DBs
NCBI-ProteinID: AEV39535
UniProt: G8PNP3
LinkDB All DBs
Position
5419265..5420641
Genome map
AA seq 458 aa AA seqDB search
MPLWKTCASESPDIYATARAVEGLAKARIPETGVSPEEAYNLVRDELYLDGNARQNLATF
CTTWVEDEVHKLMADCIDKNMIDKDEYPQTAEIEARCVHIIASLWNSPEAEETIGCSTTG
SSEAAMLGGLALKWAWRDRRKKEGKPHDKPNMVCGPVQVCWHKFAKYFDVELRQIPLSEG
SLHMRPEQLKDYVDENTICVVPTLGVTFTGVYEPVKEICQELDRLQTETGLDIPVHVDAA
SGGFVAPFLHPELLWDFRLDRVKSINASGHKFGLAPLGVGWVIWRDKKELPSDLVFNVDY
LGGNMPTFALNFSRPGGQIVIQYYNFMRLGWDGYRDIQSACAENAQYLAEKLSELPELDI
LYDGNGALPCVCYRLKHPDKAHYTLYDLSERVRMNGWQIASYPLPSDMEDTVVQRVMIRH
GVSHDAVEQLYLDIKKALNYLDKNNIKWSEAGPSFSHG
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atgccactgtggaagacatgtgccagcgaaagtcccgacatctacgccacggcccgcgcc
gttgaaggcttagccaaagcccgcattccagaaaccggagtgagccctgaagaagcctac
aatcttgtgcgggacgagctgtatctggatggcaacgcacggcaaaacctcgccacgttc
tgcaccacgtgggtggaggatgaagtccacaaactcatggctgattgcatcgacaagaac
atgatcgacaaggatgagtatccgcaaactgcagagattgaagcccgctgcgttcacatc
atcgccagcctctggaactcaccggaagccgaagaaacgatcggttgctctacaactggc
tcctcagaagccgccatgctgggtggccttgccctgaaatgggcatggagagaccgccgc
aagaaggaaggcaaacctcacgacaagcccaatatggtgtgtggccctgttcaggtgtgc
tggcacaagtttgcaaagtacttcgatgtggaactccgccagatcccactcagcgaaggc
tccctccacatgcggcctgagcagctgaaagactacgtggacgaaaacacaatctgtgtc
gtccccacattgggcgtaaccttcactggcgtttacgaacccgtcaaagaaatctgccag
gagttggataggcttcaaaccgaaaccggtttggacattccagtccatgtggacgctgca
tccggtggctttgttgcgcccttcctgcatccagaactgctgtgggatttccgcctagac
cgcgtgaaatccatcaacgcttccggccacaagttcggtctcgcacctctgggcgtgggc
tgggtaatctggcgcgataagaaagagttgccgtctgacctggtgttcaacgtcgattat
ctgggcggcaacatgccaaccttcgcgctgaacttctcccgccccggcgggcagatcgtc
atccaatattacaacttcatgcggttaggttgggatggctaccgggacatccagtccgcc
tgcgcagaaaatgctcagtatctagcagagaaactatcggaactgccggagctggatatc
ctttacgacggcaacggtgccctaccctgcgtatgctatcgcctcaaacatccggacaaa
gctcactacacgctctacgatctttcagagcgcgtgcgcatgaatggatggcaaatcgca
tcctacccgctgccatcagatatggaagacactgttgtccagcgcgtcatgatccgccac
ggcgtctctcacgatgccgtcgagcagctctacttggacatcaaaaaagccctgaactat
ctggataaaaacaacatcaagtggtccgaggcaggaccaagtttctctcacggatag

DBGET integrated database retrieval system