KEGG   Pseudomonas aeruginosa B136-33: G655_00705Help
Entry
G655_00705        CDS       T02627                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
psg  Pseudomonas aeruginosa B136-33
Brite
KEGG Orthology (KO) [BR:psg00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    G655_00705
Enzymes [BR:psg01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     G655_00705
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 HI0933_like FAD_oxidored AlaDh_PNT_C DAO FAD_binding_3 Glutaredoxin K_oxygenase NAD_binding_7 Thi4 FMO-like NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: AGI79068
LinkDB All DBs
Position
156016..157581
Genome map
AA seq 521 aa AA seqDB search
MLDANLKTQLKAYLEKVSQPFEIVASLDDSDKSRELLGLLQDIVGLTDKITLKTDGSDAR
KPSFSLNRPGADIGLRFAGIPMGHEFTSLVLALLQVGGHPSKLDADVIEQVKGIEGTFEF
ETYFSLSCQNCPDVVQALNLMAVLNPNIRHVAIDGALFQDEVEARQIMSVPSIYLNGEVF
GQGRMGVEEILAKIDTGAAARDAEKLTARDAFDVLVVGGGPAGAAAAIYAARKGIRTGVA
AERFGGQVLDTMAIENFISVQETEGPKLARALEEHVRHYEVDIMNLQRASKLVPAKNTGE
LHEVQFESGGSLKAKTLILATGARWREMGVPGEQEYKAKGVCFCPHCDGPLFKGKRVAVI
GGGNSGVEAAIDLAGIVAHVTLLEFDSKLRADAVLQRKLYSLPNVEVITSALTSEVKGDG
QKVTGLVYKDRNSEEFKSIELEGIFVQIGLLPNTEWLKGSVELSPRGEIIVDARGETSLP
GIFAAGDVTTVPYKQIVIAVGEGAKASLSAFDHLIRTSAPE
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgttggacgccaatcttaaaacccagttgaaggcctacctggaaaaggtcagccagccg
ttcgagatcgtcgcgtccctcgatgacagcgacaaatcccgcgagctgctgggcctgctg
caagacatcgtcggcctgaccgacaagatcaccctgaagaccgacggcagcgatgcgcgc
aaaccgtcgttctcgctgaaccgccccggtgcggacatcggcctgcgcttcgccggtatc
cccatgggccacgaattcacctcgctggtgctggccctgctgcaggtaggcggccacccc
tccaagctcgacgcggacgtgatcgagcaggtcaagggcatcgagggcaccttcgagttc
gaaacctacttctcgctgtcctgccagaactgcccggacgtggtccaggcgctgaacctg
atggccgtgctcaacccgaacatccgtcacgtcgccatcgacggcgcgctgttccaggat
gaggtcgaggcgcgccagatcatgtcggtgccgagcatctacctcaacggcgaagtcttc
ggccagggccgcatgggcgtggaagagatcctcgccaagatcgacaccggcgccgccgcc
cgcgacgccgagaagctgaccgcccgcgacgccttcgacgtgctggtggtcggcggtggc
ccggccggcgccgcggcggcgatctacgccgcgcgcaagggcattcgcaccggcgtcgcc
gccgagcgcttcggcggccaggtgctggacaccatggccatcgagaacttcatctcggtg
caggagaccgaaggaccgaagctggcgcgggcgctggaagagcacgtgcgtcactacgag
gtcgacatcatgaacctgcagcgcgccagcaagctggttccggcgaagaacaccggcgag
ttgcacgaggtgcagttcgagagcggcggcagcctcaaggccaagaccctgatcctcgcc
accggcgctcgctggcgcgaaatgggcgtgcccggcgagcaggaatacaaggccaagggc
gtgtgcttctgcccgcactgcgacggcccgctgttcaagggcaagcgcgtggcggtgatc
ggcggcggcaactctggcgtcgaggcggccatcgacctggccggcatcgtcgcccatgtg
accctgctggaattcgacagcaagttgcgcgccgatgccgtgctgcaacgcaagctctac
agcctgccgaacgtcgaggtgatcaccagtgccctgaccagcgaagtgaagggcgacggc
cagaaggtcaccggcctggtgtacaaggaccgcaactccgaggagttcaagtcgatcgag
ctggaaggcatcttcgtgcagatcggcctgctgcccaacaccgagtggctcaagggcagc
gtcgagctgtcgccgcgcggcgagatcatcgtcgacgcccgtggcgagacctcgctgccc
ggcatcttcgccgccggcgacgtgaccacggtgccgtacaagcagatcgtgatcgccgtg
ggcgagggcgccaaggcttcgctgagcgccttcgaccacctgatccggacctccgcgccg
gagtga

DBGET integrated database retrieval system