KEGG   Pseudomonas aeruginosa B136-33: G655_04210Help
Entry
G655_04210        CDS       T02627                                 

Definition
(GenBank) transcriptional regulator
Organism
psg  Pseudomonas aeruginosa B136-33
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HTH_18 HTH_AraC AraC_binding_2 AraC_binding
Motif
Other DBs
NCBI-ProteinID: AGI79767
LinkDB All DBs
Position
907447..908406
Genome map
AA seq 319 aa AA seqDB search
MPAHALLETRRASTQDIPLEQRLAFWEDYNASILVGLKCSSYSQAGFAATQDNLCLERLR
LARIGGNEHVVERDRSMIRAVPKESIFVSLVQGSQSFFYQDNGCNLLQPGELVIYRTDKP
YLFGFSGPMRQFIFDIPQDDFAERCLRDFKGPLKIGAESPVQRLLVRTLGERTRDFLDSP
HGEDAERYQEEAYDLLASIISDHAGEHRASALGASYLLAAKQYIQQHLDEPALSCERVAA
ATGVSSRHLARLFAQEGSSPGRYLQERRLERARQLLASPQGRRLDVAEVAYRHGFSSQAH
FARAFKARYGMTPSEARGR
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgcccgcacatgccttgctcgaaacccggcgggccagcacccaggacattcccctggag
cagcggctggcgttctgggaggactacaacgcttccatcctggttggcctgaaatgttcg
tcgtattcccaggccggcttcgccgcgacccaggacaacctctgcctcgaacgcctgcgg
ctggcccgcatcggcggcaacgagcacgtggtggagcgcgaccgctcgatgatccgcgca
gtgcccaaggagtcgatcttcgtctccctggtgcagggcagccagtcgttcttctaccag
gacaacggctgcaacctcctgcaaccgggcgagctggttatctaccggaccgacaagccc
tacctgttcggtttttccggaccgatgcggcagttcatcttcgacattccccaggacgat
ttcgccgagcgctgcctgcgcgacttcaagggaccgctgaagatcggcgcggaaagcccg
gtgcagcgcctgctggtgcggaccctcggcgagcgtacccgggatttcctcgacagcccc
catggcgaggatgccgagcgctaccaggaggaagcctacgacctgctggcgagcatcatc
agcgaccatgccggcgagcaccgtgccagcgccctgggcgcgtcctacctgctggcggcc
aagcagtacatccagcagcacctcgacgaacccgccctgagctgcgagcgggtggccgcc
gccactggcgtctccagccggcacctggcgcggctgttcgcccaggaaggcagctcgccc
gggcgctacctgcaggagcggcgcctggagcgcgcccgccagttgctcgcttcgccccag
ggccggcgcctggatgtcgccgaggtcgcctatcgccacggcttctccagccaggcgcat
ttcgcccgggccttcaaggcgcgctacgggatgacgccgagcgaggcgcgtggccgttag

DBGET integrated database retrieval system