KEGG   Pseudomonas aeruginosa B136-33: G655_04220Help
Entry
G655_04220        CDS       T02627                                 

Definition
(GenBank) 4-hydroxyphenylacetate 3-monooxygenase small subunit
  KO
K00484  flavin reductase (NADH) [EC:1.5.1.36]
Organism
psg  Pseudomonas aeruginosa B136-33
Pathway
psg00350  Tyrosine metabolism
psg00740  Riboflavin metabolism
psg01100  Metabolic pathways
psg01120  Microbial metabolism in diverse environments
psg01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:psg00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    G655_04220
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    G655_04220
Enzymes [BR:psg01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.36  flavin reductase (NADH)
     G655_04220
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Flavin_Reduct VasI
Motif
Other DBs
NCBI-ProteinID: AGI79769
LinkDB All DBs
Position
complement(908934..909446)
Genome map
AA seq 170 aa AA seqDB search
MSQLEPRQQAFRNAMAHLSAAVNVITSNGPAGRCGITATAVCSVTDSPPTLMLCINRNSE
MNTVFKANGRLCVNVLSGEHEEVARHFAGMTEVPMERRFALHDWREGLAGLPVLHGALAN
LQGRIAEVQEIGTHSVLLLELEDIQVLEQGDGLVYFSRSFHRLQCPRRAA
NT seq 513 nt NT seq  +upstreamnt  +downstreamnt
atgtcccagctcgaacccaggcaacaagccttccgcaacgccatggcgcatctttcggcg
gcggtcaacgtgatcaccagcaacggcccggccggacgctgcgggatcaccgccactgcg
gtctgctcggtcaccgacagcccgccgacgctgatgctctgcatcaaccgcaacagcgag
atgaacacggtgttcaaggccaacggtcgactctgcgtgaacgtcctcagcggcgaacac
gaagaggtggcccgccacttcgccggcatgaccgaggtcccgatggaacgccgcttcgcc
ctccatgactggcgcgagggcctcgccgggttgccggtgctgcacggcgccctggccaac
ctgcagggacgcatcgccgaggtccaagagatcggcacccattcggtgctgttgctggag
ctggaggacatccaggtcctcgaacagggcgacggcctggtctacttcagccgcagcttc
catcgcctgcaatgcccccggcgggcggcctga

DBGET integrated database retrieval system