KEGG   Pseudomonas aeruginosa B136-33: G655_05635
Entry
G655_05635        CDS       T02627                                 

Definition
(GenBank) cysteine desulfurase
  KO
K04487  cysteine desulfurase [EC:2.8.1.7]
Organism
psg  Pseudomonas aeruginosa B136-33
Pathway
psg00730  Thiamine metabolism
psg01100  Metabolic pathways
psg04122  Sulfur relay system
Brite
KEGG Orthology (KO) [BR:psg00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    G655_05635
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04122 Sulfur relay system
    G655_05635
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:psg03016]
    G655_05635
   03029 Mitochondrial biogenesis [BR:psg03029]
    G655_05635
  09183 Protein families: signaling and cellular processes
   02048 Prokaryotic defense system [BR:psg02048]
    G655_05635
Enzymes [BR:psg01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.1  Sulfurtransferases
    2.8.1.7  cysteine desulfurase
     G655_05635
Transfer RNA biogenesis [BR:psg03016]
 Eukaryotic type
  tRNA modification factors
   Thiolation factors
    G655_05635
 Prokaryotic type
    G655_05635
Mitochondrial biogenesis [BR:psg03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Proteins involved in Fe-S cluster biogenesis
    G655_05635
Prokaryotic defense system [BR:psg02048]
 DNA phosphothiolation system
  Sulfur modification proteins
   G655_05635
SSDB
Motif
Pfam: Aminotran_5 Aminotran_1_2 DegT_DnrJ_EryC1 Cys_Met_Meta_PP Beta_elim_lyase
Other DBs
NCBI-ProteinID: AGI80052
LinkDB
Position
1213690..1214904
AA seq 404 aa
MKLPIYLDYSATTPVDPRVAQKMSECLLMDGNFGNPASRSHVFGWKAEEAVENARRQVAE
LVNADPREIVWTSGATESDNLAIKGVAHFYSGKGKHIITSKIEHKAVLDTCRQLEREGFE
VTYLEPGEDGLITPALVEAALRDDTILVSVMHVNNEIGTVNDIAAIGELTRSRGVLFHVD
AAQSTGKVEIDLDKLKVDLMSFSAHKTYGPKGIGALYVRRKPRVRIEGQMHGGGHERGMR
SGTLATHQIVGMGEAFRIAKEEMAQENARVLALRDRFFAQIDGLEELYINGSMTSRVPHN
LNVSFNYVEGESLIMALKDLAVSSGSACTSASLEPSYVLRALGRNDELAHSSIRFTFGRF
TTEEEIDYAAKKVVEAVSKLRELSPLWDMYKEGVDLSQVEWQAH
NT seq 1215 nt   +upstreamnt  +downstreamnt
atgaaattgccgatctacctcgattactccgcgaccactcccgtcgatccccgcgtcgcc
cagaaaatgagcgaatgcctgctgatggacggcaacttcggcaacccggcttcgcgttcc
cacgtgttcggctggaaagccgaggaggccgtggagaacgcccgtcgccaggtggccgaa
ctggtcaacgccgatccccgcgagatcgtctggacctccggcgccaccgagtccgacaac
ctggcgatcaagggcgtcgcgcacttctactcgggcaagggcaagcacatcatcacctcg
aagatcgagcacaaggcggtcctcgacacctgccgccagctggagcgcgaaggtttcgaa
gtgacctacctggagccgggcgaagatggcctgatcactccggcactggtcgaggcggcg
ctgcgtgacgacaccatcctggtctcggtcatgcacgtgaacaacgagatcggcaccgtc
aacgacatcgccgccatcggcgagctgacccgctcccgcggcgtgctgttccacgtcgac
gccgcacagtcgaccggcaaggtcgagatcgacctggacaagctcaaggtcgacctgatg
tccttctccgcgcacaagacctacggcccgaaaggcattggcgcgctttatgtccggcgc
aagccgcgcgtccgcatcgagggccagatgcacggcggcggccacgagcgcggcatgcgc
tccggcaccctggccacccaccagatcgtcggcatgggcgaggcgttccgcatcgccaag
gaagaaatggcccaggagaacgcccgcgtgctggcgctccgcgaccgcttcttcgcgcag
atcgatggcctggaagagctctacatcaacggcagcatgacctcccgcgtcccgcacaac
ctcaacgtcagcttcaactacgtcgagggcgagtcgctgatcatggcgctcaaggacctc
gcggtctcctccggttcggcctgtacctcggcgtccctggaaccgtcctacgtattgcgc
gccctgggccgcaacgacgaactggcgcatagctccatccgcttcaccttcggtcgcttc
accaccgaggaagagatcgactatgccgcgaagaaggtggtcgaggccgtttccaagctg
cgcgaactgtcgccgctgtgggatatgtacaaagagggcgtcgacctgtcccaggtcgaa
tggcaggcgcactga

DBGET integrated database retrieval system