KEGG   Pseudomonas aeruginosa B136-33: G655_16555Help
Entry
G655_16555        CDS       T02627                                 

Definition
(GenBank) type III export protein PscK
  KO
K04054  type III secretion protein K
Organism
psg  Pseudomonas aeruginosa B136-33
Brite
KEGG Orthology (KO) [BR:psg00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:psg02044]
    G655_16555
Secretion system [BR:psg02044]
 Type III secretion system
  Type III secretion core apparatus
   G655_16555
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: YscK SpdB
Motif
Other DBs
NCBI-ProteinID: AGI82227
LinkDB All DBs
Position
complement(3666984..3667604)
Genome map
AA seq 206 aa AA seqDB search
MPLTAYQLRFCPARYIHESHLPAVLLRLLPALPDWRRQSVLNAWLLEQLELDCAFRMPAQ
LGGLALYPQAALERTLGWLGALLHGQALRQVLDGARVRRIRAQIGEQGQRFCLEQLDLLI
GRWPPGWQRALPENPEDGYFRRCGLAFWLAACSDADCGFSRRLRLRLEAMPAPADWTFDE
QRRSLARTLCLKVARQASDECFHLLN
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atgccattgacggcctaccagttgcgcttctgcccggcccgctacatccacgagtcgcac
ctgcccgcggtattgctgcggttgctgccggcgctgccggactggcggcgacagagcgtt
ctcaacgcctggctgctggagcaactggaattggactgcgcgttccgcatgcccgcgcaa
ctgggcgggctggccctttacccgcaggcggcgctggaacggaccctgggctggctcggt
gcgctgctgcacggccaggccttgcggcaggtgctggacggtgcgcgggtacggcgcatc
cgcgcgcagatcggcgaacagggccagcgtttctgcctggagcagctcgacctgctcatc
ggtcgctggccgcccggctggcagcgggccttgccggaaaacccggaagacggctatttc
cggcgctgcggcctggctttctggctggccgcctgtagcgatgccgactgcggtttctcg
cggcgcctgcgcctgcgtctggaggccatgccggccccggcggactggaccttcgacgaa
caacggcgatccctggcgcggaccctgtgcctgaaggtcgcccgacaagcgagcgatgaa
tgcttccatttgttgaactag

DBGET integrated database retrieval system