KEGG   Pseudomonas aeruginosa B136-33: G655_17295Help
Entry
G655_17295        CDS       T02627                                 

Gene name
sdhA
Definition
(GenBank) succinate dehydrogenase flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
psg  Pseudomonas aeruginosa B136-33
Pathway
psg00020  Citrate cycle (TCA cycle)
psg00190  Oxidative phosphorylation
psg00650  Butanoate metabolism
psg01100  Metabolic pathways
psg01110  Biosynthesis of secondary metabolites
psg01120  Microbial metabolism in diverse environments
psg01130  Biosynthesis of antibiotics
psg01200  Carbon metabolism
Module
psg_M00009  Citrate cycle (TCA cycle, Krebs cycle)
psg_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
psg_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:psg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    G655_17295 (sdhA)
   00650 Butanoate metabolism
    G655_17295 (sdhA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    G655_17295 (sdhA)
Enzymes [BR:psg01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     G655_17295 (sdhA)
    1.3.5.4  fumarate reductase (quinol)
     G655_17295 (sdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 DAO GIDA FAD_binding_3 HI0933_like Thi4 FAD_oxidored Pyr_redox_3
Motif
Other DBs
NCBI-ProteinID: AGI82375
LinkDB All DBs
Position
complement(3817891..3819663)
Genome map
AA seq 590 aa AA seqDB search
MASIRTLSFDAIIVGGGGAGMRAALQLAQGGHKTAVVTKVFPTRSHTVSAQGGITCAIAS
ADPNDDWRWHMYDTVKGSDYIGDQDAIEYMCSVGPEAVFELEHMGLPFSRTETGRIYQRP
FGGQSKDFGKGGQAARTCAAADRTGHALLHTLYQANLKNGTSFLNEWYAVDLVKNQDGAV
VGIIAICIETGETVYIRSKAVVLATGGAGRIYASTTNALINTGDGVGMALRAGVPVQDIE
MWQFHPTGIAGAGVLVTEGCRGEGGYLINAHGERFMERYAPNAKDLAGRDVVARSMVKEV
LAGNGVGPNKDHVLLKLDHLGEEVLHSRLPGICELSKTFAHVDPVVAPIPVIPTCHYMMG
GVATNIHGQAITQDANGNDQIVEGLFAVGEVACVSVHGANRLGGNSLLDLVVFGRAAGLH
LEKALKEGIDARGASESDLEASFKRLNGVNERTSGEEVAPLKRELQSCMQNYFGVFRTGE
YMQKGIAQLADLRERIANVKINDKSQAFNTARIEALELQNLLEVAEATAIAAEHRKESRG
AHAREDFEERDDENWLCHTLYFPGEKRVSKRSVNFAPKTVPAFEPKVRTY
NT seq 1773 nt NT seq  +upstreamnt  +downstreamnt
atggctagcattcgtacactttcctttgacgccatcatcgtcggtggcggtggcgccggc
atgcgtgccgcgctgcaactggcccagggcggccacaagaccgccgtggtgaccaaggtc
ttcccgacccgttcccacaccgtatccgcacagggcggcatcacctgcgccatcgcttcg
gccgacccgaacgacgattggcgttggcacatgtacgacaccgtcaagggctccgactac
atcggtgaccaggacgcgatcgaatacatgtgttccgtcggccccgaggccgtgttcgag
ctcgagcacatgggcctgccgttctcccgtaccgaaaccggccgcatctaccagcgtccg
ttcggcggccagtccaaggacttcggcaagggtggccaggccgcccgtacctgcgccgcc
gccgaccgtaccggccacgcgctgctgcacaccctgtaccaggccaacctgaagaatggc
acctcgttcctcaacgagtggtacgcggtcgacctggtgaagaaccaggacggcgcggtg
gtcggcatcatcgccatctgcatcgagaccggcgagaccgtctacatccgttccaaggcc
gtggtcctggccactggcggtgccggccgtatctacgcctccaccaccaatgcgctgatc
aacaccggtgatggcgtgggcatggccctgcgtgccggcgtgccggtgcaggacatcgag
atgtggcagttccacccgaccggcatcgccggcgccggtgtactggtcaccgaaggttgc
cgcggcgaaggcggttacctgatcaacgcccacggcgagcgcttcatggagcgttatgcg
ccgaacgcgaaggacctggccggccgcgacgtggtcgcccgttccatggtcaaggaagtc
ctggccggcaacggcgtgggcccgaacaaggaccacgtgctgctgaagctcgaccacctc
ggcgaggaagtcctgcacagccgcctgcctggcatctgcgaactgtccaagaccttcgcc
cacgtcgacccggtcgtcgcgccgatcccggtgatcccgacctgccactatatgatgggc
ggcgttgccaccaacatccatggccaggccatcacccaggacgccaacggcaacgaccag
atcgtcgaaggcctgttcgccgtgggcgaagtggcctgcgtatcggtacacggcgccaac
cgcctgggcggcaactcgttgctcgatctggtggtattcggccgtgccgccggtctgcac
ctggaaaaagcgctgaaagagggcatcgacgcccgcggcgcttccgagagcgacctggaa
gcctccttcaagcgcctgaacggcgtgaacgagcgcaccagcggcgaagaagtcgctccg
ctcaagcgcgagctgcaaagctgcatgcagaactacttcggtgtgttccgcaccggcgag
tacatgcagaagggcatcgcccagctggccgacctgcgcgagcgtatcgccaacgtcaag
atcaacgacaagagccaggcattcaacaccgcgcgcatcgaagcgctggaactgcaaaac
ctcctcgaggtggccgaggccaccgcgatcgcggccgagcaccgcaaggagtcccgtggc
gcccacgcccgtgaagacttcgaggagcgcgacgacgagaactggctgtgccacaccctg
tacttcccgggtgagaagcgcgtatccaagcgttccgtcaacttcgcgccgaagaccgtt
ccggcattcgaacccaaggttcggacttactaa

DBGET integrated database retrieval system