KEGG   Pseudomonas aeruginosa B136-33: G655_22720Help
Entry
G655_22720        CDS       T02627                                 

Definition
(GenBank) penicillin-binding protein 3
  KO
K03587  cell division protein FtsI (penicillin-binding protein 3) [EC:3.4.16.4]
Organism
psg  Pseudomonas aeruginosa B136-33
Pathway
psg00550  Peptidoglycan biosynthesis
psg01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:psg00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    G655_22720
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    G655_22720
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:psg01011]
    G655_22720
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:psg03036]
    G655_22720
Enzymes [BR:psg01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     G655_22720
Peptidoglycan biosynthesis and degradation proteins [BR:psg01011]
 Peptidoglycan biosynthesis and degradation
  DD-Transpeptidase (Class B PBP)
   G655_22720
Chromosome and associated proteins [BR:psg03036]
 Prokaryotic type
  Chromosome partitioning proteins
   Divisome proteins
    G655_22720
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transpeptidase PBP_dimer
Motif
Other DBs
NCBI-ProteinID: AGI83459
LinkDB All DBs
Structure
PDB: 

Position
complement(4995171..4996910)
Genome map
AA seq 579 aa AA seqDB search
MKLNYFQGALYPWRFCVIVGLLLAMVGAIVWRIVDLHVIDHDFLKGQGDARSVRHIAIPA
HRGLITDRNGEPLAVSTPVTTLWANPKELMTAKERWPQLAAALGQDTKLFADRIEQNAER
EFIYLVRGLTPEQGEGVIALKVPGVYSIEEFRRFYPAGEVVAHAVGFTDVDDRGREGIEL
AFDEWLAGVPGKRQVLKDRRGRVIKDVQVTKNAKPGKTLALSIDLRLQYLAHRELRNALL
ENGAKAGSLVIMDVKTGEILAMTNQPTYNPNNRRNLQPAAMRNRAMIDVFEPGSTVKPFS
MSAALASGRWKPSDIVDVYPGTLQIGRYTIRDVSRNSRQLDLTGILIKSSNVGISKIAFD
IGAESIYSVMQQVGLGQDTGLGFPGERVGNLPNHRKWPKAETATLAYGYGLSVTAIQLAH
AYAALANDGKSVPLSMTRVDRVPDGVQVISPEVASTVQGMLQQVVEAQGGVFRAQVPGYH
AAGKSGTARKVSVGTKGYRENAYRSLFAGFAPATDPRIAMVVVIDEPSKAGYFGGLVSAP
VFSKVMAGALRLMNVPPDNLPTATEQQQVNAAPAKGGRG
NT seq 1740 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgaattatttccagggcgccctctacccatggcggttctgcgtgatcgtcggc
ctgctgctggcgatggtcggcgccatcgtctggcgaatcgtcgacctgcacgtgatcgac
catgacttcctcaagggccagggcgacgcgcgtagcgtgcggcatatcgccatccctgcg
caccggggcctgatcacggaccgcaacggcgaaccgctggcggtgagcaccccggtcacc
accctgtgggccaaccccaaggagctgatgaccgccaaggaacgctggccgcaactggcg
gcggcgctggggcaggataccaagctgttcgccgaccgcatcgagcagaacgccgagcgc
gagttcatctacctggtccgtgggctgaccccggaacagggcgaaggtgtgatcgccctg
aaggtgccgggcgtgtactccatcgaggagtttcggcgtttctacccggctggcgaagtg
gtggcccatgcggtcggctttaccgatgtcgacgaccgcggtcgcgaaggtatcgagctg
gctttcgacgaatggctggccggcgtgccgggcaagcgccaggtgctcaaggatcgccgt
ggccgcgtgatcaaggacgtgcaggtcaccaagaatgccaaaccgggcaagacccttgcg
ctgtccatcgacctgcgcctgcagtacctggctcatcgcgaactgcgcaacgctctgctg
gagaacggcgccaaggccggcagcctggtgatcatggacgtgaagaccggggagatcctg
gccatgaccaaccagccgacctacaacccgaacaatcgtcgtaacctgcagccggcggcc
atgcgcaaccgggcgatgatcgacgtgttcgagccgggctcgacggtcaaaccgttctcg
atgagcgcggcgctggccagcgggcgctggaaacccagcgatatcgtcgacgtctacccg
ggcaccctgcagatcggccgctacaccattcgcgacgtatcgcgcaattcgcggcaactc
gatctcaccggcatcctgatcaagtcgagcaacgtcggcatcagcaagatcgccttcgac
atcggcgccgaatccatctactcggtcatgcaacaggtcggcctcgggcaggacacgggg
ttgggcttccccggcgagcgcgtcggcaacctgcccaaccaccgcaagtggccgaaggcg
gaaaccgcgaccctggcctacggctacggtctctcggtcaccgcgatccagttggcgcat
gcctatgcggccctggccaacgacggcaagagcgtgccgctgagcatgacccgagtcgac
cgcgtgccggatggcgtgcaggtgatttcgccggaagtggcttccaccgtgcagggcatg
ttgcaacaagtggtcgaggcccagggcggggtgttccgcgcccaggtgccgggttaccac
gccgccggcaagagcgggaccgcgcgcaaggtctcggtcggcaccaagggctaccgggaa
aacgcctatcgctcgctgttcgccggtttcgccccggccaccgatccgcgcatcgcgatg
gtcgtggtgatcgacgagccgagcaaggcgggctacttcggcggcctggtgtcggcgccg
gtgttcagcaaggtcatggctggcgcgctgcgcctgatgaacgtgccgccggataacctg
ccgacggccaccgaacagcagcaggtcaatgctgcgcccgcaaaaggagggcgtggctga

DBGET integrated database retrieval system