KEGG   Pseudomonas aeruginosa B136-33: G655_28540Help
Entry
G655_28540        CDS       T02627                                 

Definition
(GenBank) alcohol dehydrogenase
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
psg  Pseudomonas aeruginosa B136-33
Pathway
psg00010  Glycolysis / Gluconeogenesis
psg00071  Fatty acid degradation
psg00350  Tyrosine metabolism
psg00625  Chloroalkane and chloroalkene degradation
psg00626  Naphthalene degradation
psg01100  Metabolic pathways
psg01110  Biosynthesis of secondary metabolites
psg01120  Microbial metabolism in diverse environments
psg01130  Biosynthesis of antibiotics
psg01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:psg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    G655_28540
  09103 Lipid metabolism
   00071 Fatty acid degradation
    G655_28540
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    G655_28540
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    G655_28540
   00626 Naphthalene degradation
    G655_28540
Enzymes [BR:psg01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     G655_28540
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N AlaDh_PNT_C adh_short_C2 TrkA_N 2-Hacid_dh_C Methyltransf_25 3HCDH_N
Motif
Other DBs
NCBI-ProteinID: AGI84614
LinkDB All DBs
Structure
PDB: 

Position
6263479..6264507
Genome map
AA seq 342 aa AA seqDB search
MTLPQTMKAAVVHAYGAPLRIEEVKVPLPGPGQVLVKIEASGVCHTDLHAAEGDWPVKPP
LPFIPGHEGVGYVAAVGSGVTRVKEGDRVGIPWLYTACGCCEHCLTGWETLCESQQNTGY
SVNGGYAEYVLADPNYVGLLPKNVEFAEIAPILCAGVTVYKGLKQTNARPGQWVAISGIG
GLGHVAVQYARAMGLHVAAIDIDDAKLELARKLGASLTVNARQEDPVEALQRDIGGAHGV
LVTAVSNSAFGQAIGMARRGGTIALVGLPPGDFPTPIFDVVLKGLHIAGSIVGTRADLQE
ALDFAGEGLVKATIHPGKLDDINQILDQMRAGQIEGRIVLEM
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgaccctgccacagaccatgaaagccgcggtcgtgcacgcctacggcgcgccgctgcgg
atcgaggaagtcaaggttccgctgcccggccccgggcaggtactggtgaagatcgaagcc
tccggcgtctgccacaccgacctgcacgccgccgagggcgactggccggtgaagccgccg
ttgccgttcattcccggtcacgaaggcgtcggctacgtcgccgcggtgggcagcggagtg
acccgggtgaaggaaggcgaccgggtcggcatcccctggctgtacaccgcctgcggctgc
tgcgagcactgcctgaccggctgggagaccctctgcgaaagccagcagaacaccggctac
tcggtgaacggcggctatgccgaatacgtattggcggatccgaactacgtcggcctgttg
ccgaagaacgtcgaattcgccgaaatcgcgccgatcctctgcgccggcgtcaccgtctac
aaggggctcaagcagaccaacgcgcgccccggccagtgggtggcgatctccggcatcggc
ggcctcggccacgtcgccgtgcagtacgccagggccatgggcctgcacgtcgccgccatc
gacatcgacgacgccaagctggaactggcgcgcaagctcggtgccagcctgacggtcaac
gcccggcaggaagacccggtggaggcactccagcgcgacatcggcggcgcccacggggtg
ctggtcaccgcggtatccaacagcgccttcggccaggccatcggcatggcccgccgcggc
ggcaccatcgccctggtcggcctgccgccgggtgacttcccgacgccgatcttcgacgtg
gtgctcaagggcctgcacatcgccggctccatcgtcggcacccgcgcggaccttcaggaa
gccctcgactttgccggcgaaggcctggtcaaggcgaccatccatccgggcaagctggac
gacatcaaccagatcctcgaccagatgcgcgccgggcagatcgaggggcgcatcgtcctc
gagatgtga

DBGET integrated database retrieval system