KEGG   Pseudomonas stutzeri RCH2: Psest_0149Help
Entry
Psest_0149        CDS       T02391                                 

Definition
(GenBank) nitrate ABC transporter, permease protein
  KO
K15577  nitrate/nitrite transport system permease protein
Organism
psh  Pseudomonas stutzeri RCH2
Pathway
psh00910  Nitrogen metabolism
psh02010  ABC transporters
Module
psh_M00438  Nitrate/nitrite transport system
Brite
KEGG Orthology (KO) [BR:psh00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    Psest_0149
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    Psest_0149
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:psh02000]
    Psest_0149
Transporters [BR:psh02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   Nitrate/nitrite transporter [MD:M00438] [OT]
    Psest_0149
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1
Motif
Other DBs
NCBI-ProteinID: AGA84761
UniProt: L0GFF5
LinkDB All DBs
Position
complement(148074..148943)
Genome map
AA seq 289 aa AA seqDB search
MNANVKLQPASAEPVSIVRPSRLAALARRSGRYAVQQLVPPLVILLVLGVIWEMLCSGAD
AALPPPSQVVAETWELIIDPFYDNGGNDVGLAWQLLASLQRVAVGYLLAVVAGVGLGVLI
GQSDWAMRGLDPIFQVLRTVPPLAWLPLSLAGFQDSHPSALFVIFITAIWPIIINTAVGI
RNIPQDYRNVAQVLQLNGFEYFKTIMLPAAAPYIFTGLRIGVGLSWLAIIAAEMLIGGVG
IGFFIWDAWNASRISDIILALVYIGVVGFVLDRLVAFVGQRITRGIPAN
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgaatgccaacgtcaaactgcagcccgccagcgccgagccggtgtccatcgtccgccct
tcccgcctcgccgcactggctcggcgcagcggccgctacgctgtgcagcagctggtgcca
ccgctggtgatcctgctggtgctcggggtgatctgggagatgctctgctccggcgcggac
gccgcgctgccgccgccctcgcaggtggtcgcggaaacctgggagctgatcatcgatccg
ttctacgacaatggcggcaatgacgtgggcctggcctggcaactgctggcgagcctgcag
cgggtggcggtgggttatctgctggcggtggtcgctggggtcggcctcggcgtgctgatt
ggccagtcggactgggccatgcgcggcctcgatccgatcttccaggtgctgcgcaccgtg
ccgccactggcctggctgccgctgtcgctggcgggtttccaggacagccatccctcggcg
ctgttcgtcatcttcatcaccgcgatctggccgatcatcatcaataccgcagtgggcatc
cgcaacatcccgcaagactaccgcaacgtcgctcaggtgctgcagctcaacggtttcgag
tacttcaagaccatcatgctgccggccgccgcgccgtacatcttcaccggcctacgcatc
ggcgtcggcctgtcgtggctggcgatcatcgccgcggagatgctcatcggcggcgtcggc
atcgggttcttcatctgggatgcgtggaacgcctcgcgcatcagcgacatcatcctcgcg
ctcgtctacatcggcgtggtcggcttcgtgctcgatcgcctggtggccttcgtcggccag
cgcatcacccgcggcattccggccaactga

DBGET integrated database retrieval system