KEGG   Pseudomonas stutzeri RCH2: Psest_0801Help
Entry
Psest_0801        CDS       T02391                                 

Definition
(GenBank) CBS-domain-containing membrane protein
  KO
K07168  CBS domain-containing membrane protein
Organism
psh  Pseudomonas stutzeri RCH2
Brite
KEGG Orthology (KO) [BR:psh00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99995 Signaling proteins
    Psest_0801
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HPP CBS DUF2973 FliG_N
Motif
Other DBs
NCBI-ProteinID: AGA85394
UniProt: L0GJ97
LinkDB All DBs
Position
875814..876950
Genome map
AA seq 378 aa AA seqDB search
MHDNLIDWFRSFVPAPFNAAPKEWLRAAGGIAIVMLLSVFSGFLLFGVPLTLQLIAPAGA
SAVLLFAASSSPFAQPWSVLGGNLLATVIGVSLGLTSLPSMAAAALCVCLVLVGLFSLRC
LHPPGAALALVAVVGCPEIHHLGYGLLYPVAFNSLLLLAVALLYNNLTRHPYPKPRLPRE
NVHRTRDPQPSERMSFSHDDVDRALREFGEYVDVTRDDLERLIKQTEKHALRRSMGEVTA
ADIMSRDVYSHTPDTFIEQAWSTLQRNRLRSLPVVSDARELVGIVTLVDLLKHFHPRPGR
LNFGQLKFLRGTKLRAIMSSPVVSVTPDTHMVELVYLLSDRGLHCLPVVDGERRLVGMIT
QTDLIAALYRNWLRHLPD
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
atgcacgacaacctcatcgactggtttcgctccttcgttcccgccccgttcaatgccgcg
ccgaaagaatggctgcgtgctgccggcggtatcgccatcgtcatgctgctcagcgtgttc
agcggcttcctgctgttcggcgtgcccctgacgctgcagctgatcgccccggctggagcc
tcggcggtcctgcttttcgccgcgtcatccagcccgttcgcccagccctggtcggtgctc
ggcggcaatctgctggctacggtgatcggggtcagcctcggcctgaccagcctgccgtcg
atggctgctgccgcgctgtgcgtgtgcctggtgctggtcgggctgttcagcctgcgctgc
ctgcatccgccgggtgcggcgttggccctggttgcggtggtcggctgccccgagatccat
catctgggctatggactgctctatccggtggcgttcaattcgctgctgctgctggccgtg
gcgctgctctacaacaacctcacccggcacccgtacccgaaaccgcggttgccgcgggag
aacgttcaccgtacccgagatccgcagccgagcgagcgcatgagcttcagccatgacgac
gtcgatcgagcgttgcgcgagttcggcgaatatgtcgacgtcacccgtgacgacctcgag
cggctgatcaaacagaccgagaagcatgcgttgcgtcgcagcatgggtgaagtcaccgcc
gcggacatcatgtcccgcgatgtctactcgcacacaccggatacctttatcgagcaggcc
tggagcacgctgcagcgcaatcgcctgcgctcgttgccggtggtgagcgatgcccgcgag
ctggtcggcatcgtcacgctggtcgatctgctcaagcattttcatccgcgcccgggccgg
ctcaacttcggtcaactgaagttcctgcgcggcaccaagctgcgcgccatcatgagctcg
ccggtggtttcggtcacgcccgatacgcacatggtggagctggtctatctgctgtccgat
cgaggcctgcactgcctgccggtagtggatggcgaaaggcgcctggtcggcatgatcacc
cagaccgatctgatcgccgcgctgtatcgcaactggctccgacacctaccggactga

DBGET integrated database retrieval system