KEGG   Pseudomonas stutzeri RCH2: Psest_1134Help
Entry
Psest_1134        CDS       T02391                                 

Definition
(GenBank) alkyl hydroperoxide reductase, F subunit
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
psh  Pseudomonas stutzeri RCH2
Brite
KEGG Orthology (KO) [BR:psh00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Psest_1134
Enzymes [BR:psh01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     Psest_1134
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 GIDA HI0933_like FAD_binding_2 FAD_oxidored DAO AlaDh_PNT_C K_oxygenase FAD_binding_3 Glutaredoxin NAD_binding_8 Thi4 FMO-like
Motif
Other DBs
NCBI-ProteinID: AGA85698
UniProt: L0GG30
LinkDB All DBs
Position
1230676..1232238
Genome map
AA seq 520 aa AA seqDB search
MLDTNLKTQLKAYLEKVTQPFEIVASLDDGEKSREMLSLLQDIAGLSDKITLKTDGDDAR
KPSFSLNRIGGNISLRFAGIPMGHEFTSLVLALLQVGGHPSKTAPEVIEQIKTLEGDYRF
ETYFSLSCQNCPDVVQALNLMAVLNPNIQHVAIDGALFQDEVEARQIMSVPSIYLNGELF
TQGRMSEEEILAKLDTGSSARDAEKLKAKDAYDVLVVGGGPAGAAAAIYAARKGIRTGVA
AERFGGQVLDTMAIENFISVKETEGPKLARALEEHVREYDVDIINLQRASQLIPAGDDGL
HRVQFENGGELKAKTLILATGARWREMNVPGEQEYRGRGVAYCPHCDGPLFKGKRVAVIG
GGNSGVEAAIDLAGIVAHVTLLEFGEELRADAVLQRKLFSLPNVRVLKMAQTTEVKGDGQ
KVTGLVYKDRSSEEVHNVELEGIFVQIGLLPNSEWLKGTLELSRFGEIIVDAKGQTSIPG
VFAAGDVTTVPYKQIVIAVGEGAKASLSAFDHLIRSSAPA
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atgttggacaccaatctcaagacccagttgaaagcctacctggagaaggtcacccagccc
ttcgagatcgtcgcgtccctcgatgacggcgagaagtcccgggaaatgctgagcctgttg
caggacatcgccggcctcagcgacaagatcaccctcaagaccgacggcgacgatgcgcgc
aagccgtcgttctcgctcaaccgcatcggcggcaacatcagcctgcgcttcgccggcatc
cccatgggccacgagttcacctcgctggtgctggcgctgctgcaggtcggcggccacccg
tcgaagaccgcgccggaagtgatcgagcagatcaagacgctggagggcgactaccgcttc
gaaacctacttctcgctgtcctgccagaactgcccggacgtggtccaggcgctgaacctg
atggccgtgctcaacccgaacatccagcacgtcgccatagacggcgcactgttccaggat
gaagtcgaagcgcggcagatcatgtcggtgccgagcatctacctcaacggcgagctgttc
acccagggccgcatgagcgaggaagagatcctcgccaagctcgataccggctccagcgcc
cgtgacgccgagaagctcaaggccaaggacgcctacgacgtgctggtcgtcggtggtggc
ccggcaggcgccgcggcggcgatctacgccgcgcgcaagggcatccgcaccggcgttgcg
gccgagcgcttcggcggtcaggtgctcgacaccatggcgatcgagaacttcatctcggtg
aaggaaaccgaaggcccgaaactggcccgcgcgctggaagagcacgtgcgcgagtacgac
gtcgacatcatcaacctgcagcgcgccagccagctgattccggctggcgacgacggcctg
caccgcgtgcagttcgagaacggcggcgagctcaaggccaagaccctgattctcgccacc
ggcgcgcgctggcgcgaaatgaacgtgccgggcgagcaggagtaccgcggccgtggcgtc
gcctactgcccgcactgcgacggcccgctgttcaagggcaagcgcgtggcggtgattggc
ggcggcaactccggcgtggaagcggccatcgacctggccggcatcgtcgcccatgtgacg
ctgctggaattcggcgaggagctgcgcgccgatgccgtgctgcagcgtaaattgttcagc
ctgcccaacgtccgcgtgctgaagatggcgcagaccaccgaggtcaagggcgacggccag
aaggtcaccggcctggtctacaaggatcgcagcagcgaagaagtacacaacgtcgagctg
gagggcatcttcgtgcagatcggcctgctgcccaacagcgaatggctcaagggcaccctg
gagctgtcgcgcttcggcgagatcatcgtcgacgccaagggccagaccagcattcccggc
gtgttcgccgccggtgacgtgaccacggtgccgtacaagcagatcgtgatcgccgtcggt
gaaggcgccaaggcctcgctgagcgctttcgatcacctgatccgcagctccgcgccggcc
tga

DBGET integrated database retrieval system