KEGG   Pseudomonas stutzeri RCH2: Psest_1772Help
Entry
Psest_1772        CDS       T02391                                 

Definition
(GenBank) aspartate/tyrosine/aromatic aminotransferase
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
psh  Pseudomonas stutzeri RCH2
Pathway
psh00220  Arginine biosynthesis
psh00250  Alanine, aspartate and glutamate metabolism
psh00290  Valine, leucine and isoleucine biosynthesis
psh01100  Metabolic pathways
psh01110  Biosynthesis of secondary metabolites
psh01130  Biosynthesis of antibiotics
psh01210  2-Oxocarboxylic acid metabolism
psh01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:psh00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Psest_1772
   00290 Valine, leucine and isoleucine biosynthesis
    Psest_1772
   00220 Arginine biosynthesis
    Psest_1772
Enzymes [BR:psh01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     Psest_1772
    2.6.1.66  valine---pyruvate transaminase
     Psest_1772
Amino acid related enzymes [BR:psh01007]
 Aminotransferase (transaminase)
  Class I
   Psest_1772
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: AGA86321
UniProt: L0GJZ4
LinkDB All DBs
Position
complement(1872940..1874151)
Genome map
AA seq 403 aa AA seqDB search
MQVSKSNKLANVCYDIRGPVLKHAKRLEEEGHRILKLNIGNPAPFGFEAPEEILQDVIRN
LPTAQGYSDSKGLFSARKAIMQYYQQKQVEGVSIEDIYLGNGVSELIVMSMQALLNNGDE
VLIPAPDYPLWTAAVSLAGGKPVHYLCDEQANWWPDLADIKAKITPNTKALVLINPNNPT
GAVYPKEVLEGMVELARQHKLVLFSDEIYDKILYDDAVHISTASLAPDVLCLTFNGLSKS
YRVAGFRSGWVAISGPKHKAQSYIEGLDILANMRLCANVPAQHAIQTALGGYQSINDLVL
PPGRLLEQRNRTWELLNDIPGISCVKPMGALYAFPRIDPKICPIHNDEKFVLDLLLSEKL
LIVQGTAFNWPWPDHFRVVTLPRVDDLEQAIGRIGNFLKTYQQ
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgcaggtcagcaaatcgaacaagctcgccaatgtctgttacgacatccgtgggcccgtg
ctcaagcacgccaaacgcctggaagaggaaggccatcgcatcctcaagctgaacatcggc
aacccggcgccgttcggtttcgaagcaccggaggaaatcctccaggacgtgatccgcaat
ctgccgaccgcccagggctacagcgactcgaaaggtctgttcagcgcccgcaaggcaatc
atgcagtactaccagcagaagcaggtggaaggcgtcagcatcgaagacatctatcttggc
aacggcgtgtccgagctgatcgtgatgtccatgcaggccctgctgaacaacggcgacgag
gtgctgattcctgcgccggactacccattgtggaccgctgcggtcagtctggccggcggc
aagccggtgcattacctctgcgacgagcaggccaactggtggcctgacctggccgacatc
aaggccaagatcacgccgaacaccaaagccctggtgctgatcaatccgaacaacccgacc
ggtgcggtttacccgaaagaagtgctcgaaggcatggtggagctggcgcgccagcacaag
ctggtgctgttttctgacgagatctacgacaagatcctctacgacgacgcggtgcacatt
tccaccgcctctctcgccccggacgtgctctgcctgaccttcaacgggctgtcgaagtcc
tatcgcgtcgcaggcttccgttcgggctgggtagcgatttccgggccgaagcacaaagcg
cagagctacatcgaaggcctggatatcctcgccaacatgcgcctgtgcgccaacgtaccg
gcgcagcacgcgatccagaccgcactgggtggatatcagagcatcaacgatctggtactg
ccaccgggtcgcctgctcgagcagcgtaatcgcacctgggaactgctcaacgacattccg
ggcatcagctgcgtcaaaccaatgggcgcgctttacgcatttcctcggatcgacccgaag
atctgcccgatccacaacgatgagaagttcgtcctcgacctgctgctttccgagaagctg
ctgatcgttcagggcaccgcgttcaactggccgtggccggatcatttccgcgtggtcacc
ttgccccgcgtggacgatctggaacaggccatcggccgcatcggcaacttcctcaagacc
tatcagcagtaa

DBGET integrated database retrieval system