KEGG   Pseudomonas stutzeri RCH2: Psest_2179Help
Entry
Psest_2179        CDS       T02391                                 

Definition
(GenBank) ATP-dependent DNA ligase LigD polymerase module
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
psh  Pseudomonas stutzeri RCH2
Pathway
psh03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:psh00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    Psest_2179
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:psh03400]
    Psest_2179
Enzymes [BR:psh01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     Psest_2179
DNA repair and recombination proteins [BR:psh03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     Psest_2179
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LigD_N DNA_ligase_A_M DNA_ligase_A_C DNA_primase_S HTH_Crp_2
Motif
Other DBs
NCBI-ProteinID: AGA86713
UniProt: L0GIZ3
LinkDB All DBs
Position
2334291..2336855
Genome map
AA seq 854 aa AA seqDB search
MALEDYQRMRDFAATPEPAGKARPKSRKTQALQYCIQKHDATRLHYDFRLELDGTLKSWA
IPKGPSLDPSVRRLAVHVEDHPLEYATFEGSIPAGHYGAGDVIVWDRGVWIPEGDPRDAY
RKGKLKFALEGEKLAGSWNLVRTQMDGKKEQWFLIKSRDEAARDESDYDIVAAEPDSVLS
DRTLVPRKRGAKARVAESPPSPVKAPAKQRAPRKQKEKVALDGALPAKLPESFKPQLATL
VDSVPAGDWRYEIKFDGYRMLARIDAGEVRLFTRNGHDWTAKMPQQAAALAGLGLESGWL
DGEVVVPNEEGTPDFQALQNAFEAGRSGNILYYLFDIPYLNGMDLRDVPLEQRRAALREV
LERSDSELLRFSEDFTEQPDSILESACQMKLEGLIGKRAGSTYTSKRSSSWVKIKCSNRQ
EFIIVGYTQPKGTRTGFGALLLGLHDEKGKLLYAGKVGTGFNQATLQGLHKQLKKLETDK
SPLDKAAPAADVRGAQWLKPELMCEVAYAEMTRQGVVRHSVFHGLRSDKPAEAITHERAK
PVASQTKASAARQPDSIGSARIKISNPERVIDPSSGISKIELARFYAQIAPWALPQLQNR
PLALVRAPEGITGELFFQKHADKLAIPHITQLDPALDPKHGALLVIDSVEALVGAAQMGT
IELHSWNAVAPDLEHPDRFVLDLDPDPALPWKRMLEATQLTQTLLDEIGLASFLKTSGGK
GLHIVVPLDSVHDWTEVKSFSQAIARYLAKLLPSHFSAVSGPKNRVGRIFIDYLRNSRGA
STVAPYSVRAREGLPVSVPIHREELADLKGANLWTVRNLLERLQELGDDDPWANIGTTRQ
RLTKQMRERLGVKD
NT seq 2565 nt NT seq  +upstreamnt  +downstreamnt
atggcgctcgaagactaccaacgcatgcgcgactttgccgccacgccggagcccgccggc
aaggcacggccgaagtcgcgcaagacccaggcgttgcagtactgcatccagaagcacgac
gccacccgcctgcattatgactttcgcctggaactggacggtacgctgaagagttgggca
atccccaaggggcccagcctcgacccgagcgtgcgccggctggccgtgcatgtagaggac
catccgctggaatacgccacgttcgagggcagcatcccggcgggccattacggtgcaggt
gatgtgatcgtctgggatcgtggcgtgtggatacccgagggcgatccgcgcgacgcgtat
cgcaagggcaagctcaagttcgcacttgaaggcgaaaagctcgccggcagctggaacctg
gtgcgcacgcagatggacggcaagaaggagcagtggttcctgatcaagtcccgcgacgag
gcagcgcgcgacgagagcgactacgacattgtcgccgccgagccggatagcgtgctcagc
gaccgtacgctggtgccgcgcaagcgtggggcgaaagcacgggttgctgagtcaccgccg
agtccggtcaaggcgccagccaaacaacgggcgccacgtaagcagaaggaaaaggtcgcg
ctcgacggggcgctcccggccaagttgccggagagtttcaagccgcagctggccacgctg
gtcgattcggtaccggcgggtgactggcgctacgaaatcaagtttgacggctaccgaatg
ctcgcgcgcatcgatgccggcgaggtcagactattcacccgcaacggccatgactggacg
gcgaagatgccacagcaggctgccgcactcgccggcctggggcttgaatccggctggctg
gatggcgaagtcgtggtgccgaacgaggagggcacgccggatttccaggcgttgcagaat
gcgttcgaagccggacgcagcggcaacattctttattacctcttcgacatcccctacctg
aacggcatggatctacgcgacgtcccgctggaacaacgccgcgccgcgctgcgtgaagtg
ctggaacgcagcgacagcgagctgctgcgcttttccgaggatttcaccgaacagccggac
agcattctcgaaagcgcctgtcagatgaagctcgaaggcctgatcggcaagcgcgctggc
agcacctacacctcgaaacgcagtagcagctgggtcaagatcaagtgcagcaatcggcag
gaattcatcatcgtcggctacacccagcccaagggcacccgtaccggcttcggcgcgcta
ctgctcgggctgcatgacgagaagggcaaactgctttacgcggggaaggttggcaccggt
ttcaatcaggcaacgctgcaaggcttgcacaagcagctgaagaaactggaaaccgataag
agtccgctggacaaggctgcgcctgcagccgatgtgcgcggcgcgcagtggctcaagccc
gagttgatgtgcgaagtcgcctatgccgaaatgactcggcagggggtggtccgccattcg
gtgttccatggcttgcgcagcgacaagccggccgaggcgattacccatgaacgggccaag
ccggtcgccagtcagacgaaggcgagcgcagcgcgccagcccgactccattggcagtgcg
cggatcaagatatccaatccggagcgggtcatcgaccccagcagcggcatcagcaagatc
gagctcgcccgcttctatgcgcagatcgcaccctgggcgttgccgcaattgcagaaccgg
cctctggcgctggtccgcgcaccggaaggcatcaccggcgagctgttcttccagaagcac
gccgacaagttggccatcccgcatatcactcagctcgacccggcgctcgacccaaaacat
ggcgcgctgctggtgatcgacagcgtcgaggcgctggtgggcgcggcacagatgggcacc
atcgaactgcacagctggaacgccgtggcgcccgacctggagcacccggatcgcttcgtg
ctggatctcgatccagacccggccttgccgtggaagcgcatgctcgaggcaacccaactg
actcagacgctgctggacgagatcgggctcgcgtcgtttctcaagaccagcggcggcaag
ggcttgcatatcgtcgtaccgctggacagcgtgcatgactggacggaggttaaaagcttc
agccaggccattgccagatatctggcgaaacttctgccgtcgcacttctcagcagtcagc
ggcccgaagaaccgcgtcggacgcatcttcatcgactatctgcgcaacagccgcggcgcc
agcaccgtagcgccgtattcggtacgcgcccgcgaaggcctgccggtttccgtgcccatt
caccgcgaagagctggcagacctcaagggcgccaacctgtggacggtgcgcaacctgctc
gagcgcctacaggaactgggtgacgacgacccatgggcgaacatcggcacaacccgtcag
cgcctgaccaagcagatgcgcgagcgtcttggcgtgaaggattaa

DBGET integrated database retrieval system