KEGG   Pseudomonas stutzeri RCH2: Psest_3006Help
Entry
Psest_3006        CDS       T02391                                 

Definition
(GenBank) nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase
  KO
K00768  nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase [EC:2.4.2.21]
Organism
psh  Pseudomonas stutzeri RCH2
Pathway
psh00860  Porphyrin and chlorophyll metabolism
psh01100  Metabolic pathways
Module
psh_M00122  Cobalamin biosynthesis, cobinamide => cobalamin
Brite
KEGG Orthology (KO) [BR:psh00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Psest_3006
Enzymes [BR:psh01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.21  nicotinate-nucleotide---dimethylbenzimidazole phosphoribosyltransferase
     Psest_3006
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DBI_PRT Mg_chelatase
Motif
Other DBs
NCBI-ProteinID: AGA87505
UniProt: L0GQ68
LinkDB All DBs
Position
complement(3194548..3195597)
Genome map
AA seq 349 aa AA seqDB search
MDEWWNGACQPLDAVMRERALARQDQLTKPQGALGRLEQLAVELAALQGCERPQAERVHI
SVFAGDHGVMEEGVSAFPQAVTGQMLRNFVAGGAALSVLARRLAAPLEVIDLGTVEPLQL
DGVSHLRLGPGTANFMRQPAMSEQQLWQALAAGREAAQRAAAGGAQLFIGGEMGIGNTSS
AAALAAVLLPRSPLTLVGPGTGLDVPGVRHKEQVIQSAVRLHAAHCGAPLEALRRLGGFE
VAALTGAYLGCAQLGVPVLVDGFICSAAALCAVRLNPASRPWLLFAHRSAEPGHLALLEA
LEATPLLDLGLRLGEGSGAALAVPLLQQACALHNEMATFAEAAVSGQSA
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atggacgaatggtggaatggagcatgccagccactggatgcggtgatgcgcgagcgcgca
ctggcccggcaggaccagctgaccaagccgcagggcgcgctcgggcggctggagcagctg
gcggtcgagctggcagccctgcagggctgcgaacgaccgcaggcggagcgcgtacatatc
agcgtgttcgccggcgatcacggggtgatggaggagggcgtttcggccttcccgcaggcg
gtgaccgggcagatgctgcgcaacttcgtcgctggcggcgcggcactcagcgtgctggca
cgccggctggctgcgccgctggaagtgatcgatctgggcacggtcgagccgttgcagctg
gacggcgtcagccatctgcggctcggtccgggtacggccaacttcatgcggcagccggcg
atgagcgagcagcagttgtggcaggcgctggcggctgggcgggaagctgcgcagcgcgcg
gcagccggcggggcgcagctattcatcggcggcgagatgggtatcggcaacaccagcagt
gccgccgcgctggcggccgtgctgctgccgcgttcaccgctaaccttggtcgggccgggg
acaggattggatgtacccggcgttcgacacaaggaacaggtcatccagagcgccgtgcgg
ttgcatgccgcgcactgcggcgcgccactggaagccctgcgccgacttggcggcttcgaa
gtggcggcgttgaccggagcctatctgggctgtgcgcagctcggtgtcccggtgctggtc
gatggcttcatctgcagcgccgccgcgctgtgcgcggttcgcctgaatccggcgtcccgg
ccctggctgctgttcgcccatcgctccgccgagcccggccacctggcgttgctggaggcg
ctcgaggcgacgccgctgctcgacctcggcctgcgcctcggcgagggcagcggtgcggcg
ctggcggtgccgctgctgcagcaggcctgcgcgttgcacaacgagatggccaccttcgcc
gaggcggcggtttcgggtcagtcggcgtga

DBGET integrated database retrieval system