KEGG   Pseudomonas stutzeri RCH2: Psest_3214Help
Entry
Psest_3214        CDS       T02391                                 

Definition
(GenBank) phosphotransacetylase
  KO
K13788  phosphate acetyltransferase [EC:2.3.1.8]
Organism
psh  Pseudomonas stutzeri RCH2
Pathway
psh00430  Taurine and hypotaurine metabolism
psh00620  Pyruvate metabolism
psh00640  Propanoate metabolism
psh00680  Methane metabolism
psh01100  Metabolic pathways
psh01120  Microbial metabolism in diverse environments
psh01200  Carbon metabolism
Module
psh_M00579  Phosphate acetyltransferase-acetate kinase pathway, acetyl-CoA => acetate
Brite
KEGG Orthology (KO) [BR:psh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Psest_3214
   00640 Propanoate metabolism
    Psest_3214
  09102 Energy metabolism
   00680 Methane metabolism
    Psest_3214
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    Psest_3214
Enzymes [BR:psh01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.8  phosphate acetyltransferase
     Psest_3214
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PTA_PTB AAA_26 DRTGG CbiA
Motif
Other DBs
NCBI-ProteinID: AGA87709
UniProt: L0GQX3
LinkDB All DBs
Position
3382283..3384379
Genome map
AA seq 698 aa AA seqDB search
MHTIFLAPTGFGGGLNSISLGLIRALENAGLKVGFFKPIAQPFPVDQGRERSCILVERTL
KLTSPEPLPLEQVERQLADGEIDLLLEDVVSRYQQVAAGKDVVIVEGMVPTRESNYTQRI
NTQLAKSLDAEVILIAAQGNDSLKRLAERIEIQAQLYGGAKDPKVLGVILNKVKTEEGLP
AFIDSLKQHLPLLGSADFQLLGAIPFSEELNALRTRDIAELLGAQVLNAGEADQRRVNKI
VLCARAVPNTVQLLQSGVLVVTPGDRDDIILAASLASLNGEKLAGLLLCSDFAPDPRILE
LCKAALDGGLPVMTVETNSYDTANNLFGLNKETPADDIERATRVTDFIAKHLHPEFLHTR
CSVPRGELRMSPAAFRYQLVKRAQDANKRIVLPEGNEPRTIRAAAICQERGIARCVLLAK
PEEVQQVAREQGISLPASLEILDPDSIANRYVEPMCEMRKAKGLTPEDAREQLKDTVVLG
TMMLALDEVDGLVSGAVHTTANTIRPALQLIKTAPGYSLVSSVFFMLLPDQVLVYGDCAV
NPNPSATELAEIALQSAESAVALGVNPRVAMISYSTGSSGSGAEVEKVAEATRIAQERAP
ALPIDGPLQYDAASVLSVGKQKAPNSKVAGQATVFIFPDLNTGNTTYKAVQRNANCLSVG
PMLQGLAKPVNDLSRGALVDDIVFTIALTALQAANQKG
NT seq 2097 nt NT seq  +upstreamnt  +downstreamnt
atgcacacaatcttcctcgcccctaccggtttcggcggcggcctcaattccatcagcctc
ggcctgatccgtgcgctggaaaacgctgggctgaaggtcggcttcttcaagccgatcgcg
caacccttccccgtcgaccagggccgtgagcgctcctgcattctggtcgagcgcacgctg
aaactgacctcccccgagccactgccactggaacaggtagagcgccagctcgccgatggc
gagatcgatctgctgctcgaggacgtggtcagccgctaccagcaggtagccgccggcaag
gacgtggtcatcgtcgaaggcatggtgccgactcgcgagtcgaactacacccagcgcatc
aacacacaactggcgaagagtctcgacgccgaagtgatcctgatcgccgctcagggcaat
gacagcctcaagcgtctggccgaacgcatcgagatccaggcgcagctgtatggcggcgcc
aaggatcccaaggtgctcggcgtcatcctcaacaaggtgaagacagaggaaggcctgccg
gcattcatcgacagcctgaagcagcacctgccgctgctgggcagtgccgacttccagctg
cttggcgcaattccgttctcggaagaactcaacgcactgcgcacccgtgacatcgccgaa
ctgctcggcgcgcaggtgctcaacgccggcgaagccgaccagcgccgcgtcaacaagatc
gtgctgtgcgcacgtgccgtccccaacaccgtgcagctgctgcaatccggcgttctggtg
gtcacgcctggcgatcgcgacgacatcatcctcgccgccagcctggcctctttgaatggt
gagaagctcgcaggcctgctgctgtgcagcgacttcgcaccggacccgcgcatcctcgag
ctgtgcaaggccgccttggacggcggcctgccggtgatgaccgtggagaccaactcctac
gacacggcgaacaacctgttcggcctgaacaaggaaaccccggcggacgatatcgagcgc
gccacgcgcgtgaccgacttcatcgccaagcacctgcaccccgagttcctgcatacccgc
tgcagcgtgccgcgcggtgagctgcgcatgtcgccggcagcattccgctatcagctggtc
aagcgcgcccaggacgccaacaagcgcatcgtgctgccggaaggcaacgagccgcgcacc
atccgtgccgccgccatctgccaggagcgtggcatcgctcgctgcgtgctgctggccaag
ccggaagaagtccagcaggtcgcccgcgagcaaggcatcagcctgccggccagcctggag
atcctcgacccggacagcattgccaaccgctacgtcgagccgatgtgcgagatgcgcaag
gccaagggcctgaccccggaagatgcccgcgagcagctgaaggacaccgtcgtcctcggc
accatgatgctggcgctggacgaagtggacggcctggtttccggtgcggtgcacaccacc
gccaacaccatccgccccgcgctgcagctgatcaagacagcaccgggctacagcctcgtg
tcctcggtattcttcatgctgctgccggaccaggtactggtctatggcgactgcgccgtg
aacccgaatccgagcgctaccgagctggccgaaatcgcactgcaaagtgccgaatccgct
gtagccctgggcgtcaacccgcgcgtggcgatgatcagctactccaccggcagctccggc
agcggtgcggaagtcgagaaggtcgccgaagccacccgtatcgcccaggagcgcgctcct
gccctgccgatcgatggcccgctgcagtacgacgccgcctcggtgctgagtgtcggcaag
cagaaggcgccgaacagcaaggtggccggccaggccacggtgttcatcttccccgacctg
aataccggcaataccacctacaaggcggtacagcgcaacgccaactgcctcagcgtcggc
ccgatgctgcaaggtctggccaagccggttaacgatctgtcgcgtggcgcactggtggac
gacatcgttttcaccatcgctctgaccgctctgcaggccgccaaccagaagggctga

DBGET integrated database retrieval system