KEGG   Pseudomonas stutzeri RCH2: Psest_3839Help
Entry
Psest_3839        CDS       T02391                                 

Definition
(GenBank) Fe-S oxidoreductase
  KO
K11473  glycolate oxidase iron-sulfur subunit
Organism
psh  Pseudomonas stutzeri RCH2
Pathway
psh00630  Glyoxylate and dicarboxylate metabolism
psh01100  Metabolic pathways
psh01110  Biosynthesis of secondary metabolites
psh01120  Microbial metabolism in diverse environments
psh01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:psh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Psest_3839
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CCG Fer4_7 Fer4_8 Fer4_17 Fer4_16 Fer4_6 Fer4 Fer4_10 Fer4_9 Fer4_2 Fer4_4 Fer4_21 Fer4_20
Motif
Other DBs
NCBI-ProteinID: AGA88314
UniProt: L0GSM3
LinkDB All DBs
Position
complement(4009979..4011196)
Genome map
AA seq 405 aa AA seqDB search
MQTNLSEAAKKLPRAEEAESILRSCVHCGFCNATCPTYQLLGDELDGPRGRIYLMKQMFE
GGEVTESTQLHLDRCLTCRNCETTCPSGVKYHNLLDIGRDFIEQQVQRPLGERVVRGGLR
TVIPRPGLFKALLGAGNALKPLMPASLKDHLPREIRPAKPRPQVMHSRRVLILEGCVQPS
LSPSTNAAAARVLDRLGISVSPAREAGCCGAVDYHLNAQDAGLDRARRNIDAWWPAIEAG
AEAIVQTASGCGAFVKEYGHLLKDDPAYAAKAARVSELAKDLVEVLRSAELEKLNVRADK
RMAFHCPCTLQHAQKLGGAVEDVLTRLGYQLTAVPDAHLCCGSAGSYSITQPEISHQLRD
NKLNALESGKPEVIVTANIGCQTHLDGAGRTPVKHWIEVVEESMQ
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaccaatctgagcgaagcggcgaaaaagctgccgcgcgccgaagaagctgaaagc
atcctgcgctcctgcgtgcattgcggcttctgcaatgccacctgcccgacctaccagctg
ctcggcgacgagctggacggcccgcgcgggcgcatctacctgatgaagcagatgttcgaa
ggcggcgaggtgaccgaaagcacccagctgcacctggaccgctgcctgacctgccgcaac
tgcgaaaccacctgtccgtccggggtgaagtaccacaacctgctggacatcggccgcgac
ttcatcgagcagcaggtgcagcgcccgttgggcgagcgcgtcgtgcgcggcggcctgcgc
acggtgatcccgcgtccgggcctgttcaaggcactgctgggcgccggcaatgcgctgaag
ccgctgatgccggcctcgttgaaggaccacctgccgcgcgagatccgcccggccaagccg
cgcccgcaggtcatgcacagccgtcgcgtgctgatactcgaaggctgcgtgcagccgagc
ctgtcgccgagcaccaacgccgccgccgcgcgcgtgctcgaccgcctgggcatcagcgtc
agtccggcgcgcgaagccggctgctgcggcgcggtggattaccacctcaacgcgcaggat
gccggcctggaccgcgcacggcgcaacatcgacgcctggtggccggccatcgaagccggt
gccgaagccatcgtgcagaccgccagcggctgcggtgccttcgtcaaggaatacggtcat
ctgctcaaggatgacccggcctacgccgccaaggccgcgcgggtcagcgagctggccaag
gatctggtcgaagtgctgcgcagcgccgagctggaaaagctcaatgtgcgcgccgacaag
cgcatggccttccattgcccgtgcaccctgcagcacgcacagaagctcggcggcgcggtc
gaagacgtgctcacccgcctgggctaccagctcaccgcggtgccagatgcgcacctgtgc
tgtggctcggccggcagctattcgatcacccagccggagatttcccaccagctgcgcgac
aacaagctcaacgcgctggagagcggcaagccggaagtgatcgtcaccgccaacatcggc
tgccagactcacctcgacggcgccggccgcacgccggtcaagcactggatcgaagtggtc
gaggaatcgatgcagtag

DBGET integrated database retrieval system