KEGG   Plesiomonas shigelloides: SAMEA2665130_1727Help
Entry
SAMEA2665130_1727 CDS       T04378                                 

Gene name
sodB
Definition
(GenBank) Superoxide dismutase [Fe]
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
pshi  Plesiomonas shigelloides
Brite
Enzymes [BR:pshi01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     SAMEA2665130_1727 (sodB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: SBT61236
UniProt: A0A1A9AX10
LinkDB All DBs
Position
1:1922004..1922585
Genome map
AA seq 193 aa AA seqDB search
MSFELPALPYAKNALEPHLSAETLEYHYGKHHNTYVVNLNNLVPGTEFEGKSLEDIVKTS
SGPIFNNAAQVWNHTFYWNCLAPQAGGEPTGALADAINQAFGSFDAFKTQFNDAAVKNFG
SGWTWLVKKADGSLAIVNTSNAGCPLTEGHTPLLTVDVWEHAYYIDYRNVRPNYLNGFWA
LVNWNFVAKNLAA
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atgtcttttgaattacctgcactgccatatgcaaaaaatgcactggaaccacacctgtca
gctgaaacgctggagtatcactacggtaagcaccacaacacctacgtggttaacctgaac
aatctggttcctggcactgagttcgaaggcaagtctctggaagatatcgttaaaacctct
tccggcccgatctttaacaacgccgctcaagtctggaaccacactttctactggaactgc
ctggcaccacaagcgggtggcgagcctaccggcgcactggctgatgcaatcaatcaagca
ttcggctcttttgacgcgttcaaaactcagttcaacgacgcagcagtgaagaacttcggc
tctggctggacttggctggtgaagaaagctgacggctctctggcaatcgtgaacacctct
aacgctggctgcccactgactgaaggtcacactccactgctgactgtggacgtgtgggag
cacgcttactacatcgattaccgcaacgtacgtcctaactacctgaatggtttctgggcg
ctggtaaactggaacttcgtcgctaaaaatctggccgcgtaa

DBGET integrated database retrieval system