KEGG   Plesiomonas shigelloides: SAMEA2665130_1903Help
Entry
SAMEA2665130_1903 CDS       T04378                                 

Gene name
trpE
Definition
(GenBank) Anthranilate synthase component 1
  KO
K01657  anthranilate synthase component I [EC:4.1.3.27]
Organism
pshi  Plesiomonas shigelloides
Pathway
pshi00400  Phenylalanine, tyrosine and tryptophan biosynthesis
pshi01100  Metabolic pathways
pshi01110  Biosynthesis of secondary metabolites
pshi01130  Biosynthesis of antibiotics
pshi01230  Biosynthesis of amino acids
pshi02024  Quorum sensing
Module
pshi_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:pshi00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SAMEA2665130_1903 (trpE)
  09110 Biosynthesis of other secondary metabolites
   00405 Phenazine biosynthesis
    SAMEA2665130_1903 (trpE)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    SAMEA2665130_1903 (trpE)
Enzymes [BR:pshi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.27  anthranilate synthase
     SAMEA2665130_1903 (trpE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Chorismate_bind Anth_synt_I_N
Motif
Other DBs
NCBI-ProteinID: SBT61411
LinkDB All DBs
Position
1:2098367..2099995
Genome map
AA seq 542 aa AA seqDB search
MASLIQILQRDVPYHQDPTLIFQALCAEQAACLLLDSAEIDSKENLKSLLLIDAALRIAC
QGNQVNVQAHSDNGRRLLDVLQHKLPDSVDALRESAALTLRFPAGAAHSATAQDEDSRLK
SLSVFDSVRALLHGLSFDPQHPHALFIGGLFAYDLAAQFEPMPEVGSQQQCPDFCLYVAE
TLLIIDHQHRQAHLQASLFAHCQHEQQRLSDRLLQLNQQLHHLPAPAQAPEASIAHLHLS
QSDAEFCTTVQTLKQHILCGDIFQVVPSRRFSLPCPHPLAAYRELKRSNPSPYMFYLQDP
LFTLFGASPESALKFSADTRQVEIYPIAGTRPRGKTVQGDIDRDLDSRLELDLRLDKKEL
AEHMMLVDLARNDVARISEPGSRYVADLLHVDRYSHVMHLVSRVVGTLRSDLDALHAYQA
SMNMGTLTGAPKIRAMQLIYQTEQTRRGSYGGAVGYMNGQGDLDTCIVIRSAYVENGIAC
VQAGAGVVYDSVPQAEADETRAKAQAVISAIARAHQFTLHESVPQSQAALLGQTNVQEAS
SC
NT seq 1629 nt NT seq  +upstreamnt  +downstreamnt
atggcctcactgattcagattttacagcgcgatgttccgtatcatcaggatcccaccctg
atttttcaggctctgtgcgccgaacaagcggcctgcttactgctggattcagctgaaatt
gatagcaaggaaaacctgaaaagtttgctgctgattgatgccgcattgcggatcgcttgc
caagggaatcaggtcaacgtgcaggcgcacagtgataacggacgccgcctgctggatgtg
ttgcaacacaagctaccagacagcgtagatgccctgcgtgagtctgctgcgttaacacta
cgctttcccgcaggagccgcccactctgcgacggcgcaagatgaagattcacggctgaaa
agtttgtcagtatttgacagtgtgcgcgcgttactgcacggcttgagttttgaccctcag
cacccgcatgccctgtttatcggtggactgttcgcctacgatttagcggcccaattcgag
ccaatgcccgaggtgggaagccagcagcaatgccctgatttttgcctttatgtggccgaa
acgttgctgatcatcgaccaccagcaccgccaagcgcacctgcaggcgtctttatttgcg
cactgccagcatgagcagcagcgcttaagtgaccgcttattgcagctcaaccaacaactg
caccacttgccagcgccggcgcaggcaccagaagcgagcatcgcccacttgcaccttagc
caatcggatgcggaattttgtaccaccgtgcaaacgctgaagcagcatattttgtgcggc
gatatttttcaggtggtgccgtctcgccgtttcagcttgccgtgcccacacccgttagcg
gcttaccgcgaactcaagcgcagtaaccccagcccatacatgttttacctgcaagatccg
ctgttcacgctattcggggcatctccggaaagtgccttgaagttcagcgccgatacacgc
caagtcgaaatctaccccatcgccggcacccgtcctcgcggtaaaactgtacagggcgac
atagaccgcgatctggatagccgactggagctggatttacggttggataaaaaagagcta
gccgagcacatgatgctggtcgacttggcgcgcaatgacgttgcccggatcagcgagccg
ggtagccgctatgtggccgatctgctgcacgtcgaccgctattcccacgtcatgcattta
gtctcacgcgttgttggcactctgcgtagtgatcttgatgccctgcacgcctatcaagcc
agcatgaacatgggcaccctgaccggcgcgcccaaaattcgcgcgatgcagctgatttat
caaaccgaacaaactcgccgtggcagctacggtggcgcagtaggttacatgaatggccaa
ggcgatctggatacttgcatcgtgatccgctcagcctacgtcgaaaatggtatcgcctgt
gtgcaagccggtgccggtgtggtgtacgactcggtaccacaagccgaagccgacgaaacc
cgcgctaaggcacaagcggtgatcagtgctatcgcccgcgctcaccaatttacgctgcac
gaatccgtgcctcagagccaagcggcattgctcgggcaaaccaacgtacaggaggcatca
tcatgctaa

DBGET integrated database retrieval system