KEGG   Providencia stuartii MRSN 2154: S70_00465Help
Entry
S70_00465         CDS       T02042                                 

Definition
(GenBank) superoxide dismutase copper/zinc binding protein
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
psi  Providencia stuartii MRSN 2154
Brite
Enzymes [BR:psi01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     S70_00465
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-ProteinID: AFH91996
UniProt: A0A140NII9
LinkDB All DBs
Position
complement(85638..86162)
Genome map
AA seq 174 aa AA seqDB search
MKFKMCLLAGLLTAFAANAAETTVVLKEATPQGEGKAIGEVVISETDYGLLFTPKLAGLE
AGIHGFHIHENPSCEPAEKDGKSVPALKAGGHMDPAKTGVHKGPYDNTGHLGDLPGLVVD
AKGNADYAVLAPRLKTLKEIENRALMVHAGGDNYSDHPEALGGGGARMACGVIK
NT seq 525 nt NT seq  +upstreamnt  +downstreamnt
atgaaattcaaaatgtgtttactggccggcttattaacggcttttgcagcaaatgcagca
gaaacaacagtagtactgaaagaagctacaccacaaggtgaaggcaaggcgattggtgaa
gttgttatttctgaaaccgattatggattattgtttaccccaaaattagcaggtttagaa
gcgggtatccatggtttccatatccatgaaaacccaagctgtgagcctgctgaaaaagat
ggcaaatcagtaccagcattaaaagcaggtggacatatggatccggcaaaaacaggtgtc
cataaagggccttatgacaatacaggccacttaggggatcttccgggcttagtggttgat
gccaaaggtaatgccgattatgccgtattagcaccgcgcttaaaaacactaaaagagatt
gaaaaccgtgcactgatggtacacgcgggtggggataattactccgaccatcctgaagcg
ttaggtggtggtggtgcacgcatggcttgtggtgtgatcaaatag

DBGET integrated database retrieval system