KEGG   Providencia stuartii MRSN 2154: S70_10085Help
Entry
S70_10085         CDS       T02042                                 

Gene name
aroB
Definition
(GenBank) 3-dehydroquinate synthase
  KO
K01735  3-dehydroquinate synthase [EC:4.2.3.4]
Organism
psi  Providencia stuartii MRSN 2154
Pathway
psi00400  Phenylalanine, tyrosine and tryptophan biosynthesis
psi01100  Metabolic pathways
psi01110  Biosynthesis of secondary metabolites
psi01130  Biosynthesis of antibiotics
psi01230  Biosynthesis of amino acids
Module
psi_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:psi00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    S70_10085 (aroB)
Enzymes [BR:psi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.4  3-dehydroquinate synthase
     S70_10085 (aroB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHQ_synthase Fe-ADH_2 Fe-ADH
Motif
Other DBs
NCBI-ProteinID: AFH93876
UniProt: A0A140NNX1
LinkDB All DBs
Position
2157007..2158101
Genome map
AA seq 364 aa AA seqDB search
MEKVTVTLDERSYPITIAPGLYNQPDAFWPLKAGQRAMLVTNETLAPIYLEKVTRALEAA
GITVDSIILPDGEQYKSLFIMNDVFTALLEKRHNRDTTLIALGGGVIGDLTGFAAASYQR
GVRFIQVPTTLLSQVDSSVGGKTAVNHPLGKNMIGAFYQPASVIIDLDCLKTLPKRELSS
GLAEVIKYGIILDGEFFSWLEANIDALMALDNQAMAYCIRRCCELKAQVVAADEKETSGL
RALLNLGHTFGHAIEAHMGYGVWLHGEAVAAGMVMAAKTAERIGTFTAHQTQRIIALLER
AELPVTGPEQMKPDDYLPHMMRDKKVMGGKLHLILPTTIGHAEMRSDIETQTVRDAISSC
LPET
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaagtcactgttactctggatgaacgcagttatccaatcacaattgctccgggt
ctttataaccaaccagatgctttttggccactcaaagcgggtcaacgagctatgttggtg
accaacgagacacttgcgcctatctatcttgagaaagtgacgcgtgctcttgaagcagca
gggataacagtagattcaatcattttaccggatggggaacagtataaatccttgttcatt
atgaacgatgttttcactgccttactcgaaaaacgccataatcgcgataccaccctcata
gcacttggtgggggtgttatcggtgacctaacaggtttcgccgcagcaagttatcaacgt
ggggttcgttttatccaagtaccaaccaccttgttatcacaagtagattcatccgtaggc
ggcaaaaccgcggtaaaccatccattaggcaaaaatatgatcggggcattttatcagccc
gcctctgtcatcatcgaccttgattgcttaaaaacgttaccgaaaagagaactttcatct
ggtcttgctgaggtcatcaagtatggcatcatccttgatggggagtttttcagctggcta
gaagcgaatatcgacgctctaatggctcttgataatcaagccatggcttactgcatccgt
cgctgctgtgaattaaaagcacaggtcgtcgcggctgatgagaaagagactagcggctta
agggcgctacttaaccttggccatacttttggtcatgctattgaagcccatatgggctat
ggcgtttggctgcacggtgaagccgttgcagcaggtatggtgatggcggctaaaacggca
gaacgcataggcacattcaccgcacaccaaactcagcgaattatcgccttgttagaacgc
gctgagctacctgtgacgggtcctgagcaaatgaaaccggatgactatttacctcatatg
atgcgggataaaaaggtcatgggcgggaaactccatcttatcttacctaccacaatcggc
catgcagaaatgcgctcagatattgaaacacaaacagtacgagatgcgatatcgtcctgt
ttacccgaaacctaa

DBGET integrated database retrieval system