KEGG   Providencia stuartii MRSN 2154: S70_11215Help
Entry
S70_11215         CDS       T02042                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
psi  Providencia stuartii MRSN 2154
Pathway
psi00620  Pyruvate metabolism
psi00680  Methane metabolism
psi01100  Metabolic pathways
psi01120  Microbial metabolism in diverse environments
psi01200  Carbon metabolism
Module
psi_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:psi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    S70_11215
  09102 Energy metabolism
   00680 Methane metabolism
    S70_11215
Enzymes [BR:psi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     S70_11215
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: AFH94093
UniProt: A0A140NMJ1
LinkDB All DBs
Position
2411442..2414081
Genome map
AA seq 879 aa AA seqDB search
MNQQYSAMRSNVSMLGKLLGDTIKEALGEDILDKVESIRKLSKSSRAGNEVQRQKLLMTL
QNLSNDELLPVARAFNQFLNLTNVAEQYHSISPHGEAASNPVALKKLFSRLKEKNFTDSD
LRQAVNQLSIELVLTAHPTEIARRTLIHKLVEVNTCLSQLDHDDLADYERNNIMRRLRQL
VAQSWHTDEIRKIRPTPIDEAKWGFAVVENSLWEAVPAFLREFNEQLEDSIGAELPVEAN
PIRFTSWMGGDRDGNPNVTAEVTRHVLLLSRWKAADLFLKDIQVLVSELSMTEATPELRA
LAGGDEVDEPYRQIAKNLRSQLFSTLEYLERKVKGEQALPPADLLTDNAQLWDPLYACYQ
SLMACGMSIIANGQLLDTLRRIRSFGLQLVRIDVRQESTRHTEALAELTQYLGLGDYAAW
SEEEKQAFLLSELQSRRPLIPRHWQPSPETAEVFETCRVIAESKNDSIAAYVISMAKVPS
DVLAVKLLLKEAGASVRLPVAPLFETLEDLNNAESVMQKLLSIEWYRELIDDRQMVMIGY
SDSAKDAGVMAASWAQYRAQDALIKLCDKEGVTLTLFHGRGGTIGRGGAPAHSALLSQPP
GSLKGGLRVTEQGEMIRFKFGLPQVAISSLALYASAILEANLLPPPEPKQEWKSVMDTLS
DVSCAMYRDYVREQPDFVPYFRAATPELELGKLPLGSRPAKRRPTGGVETLRAIPWIFAW
TQNRLMLPAWLGAGAALKYVIEKEGKQAILDEMWQQWPFFNTRIAMLEMVYAKADLWLAE
YYDHRLVEERLWPLGVKLREQLSEDIKSVLAVSKDEALMADLPWIAESIVLRNVYTDPLN
VLQAELLHRSRQQEHPDPRVEQALMVTIAGVAAGMRNTG
NT seq 2640 nt NT seq  +upstreamnt  +downstreamnt
atgaatcagcaatattccgcaatgcgcagtaatgtcagtatgctgggtaagctacttggc
gacacaatcaaggaagcattaggtgaggatatcctcgataaagtcgaatcaattcgtaag
ttgtcaaaatcatcgcgtgcaggcaatgaagtacaacgccaaaagctgttgatgacactg
caaaacctatctaatgatgaactattaccggttgcaagagcatttaaccaatttttgaac
ctgacaaacgttgccgaacaatatcatagcatttcgccacatggtgaagcagcgagtaac
cctgtggcacttaaaaagctgtttagtcgtttaaaagagaaaaactttaccgatagtgat
cttcgtcaagcggttaaccaactgtcgatcgaattggtgctaacggcccatcctactgaa
atcgcacgccgcaccttgatccataaattggttgaagtgaatacctgcttatcacaactc
gatcatgatgatctggctgattacgaacgcaacaatatcatgcgtcgtttacgccagttg
gtcgctcagtcgtggcacactgacgaaatccgtaaaatacgtccaacgccaattgatgaa
gccaaatggggttttgccgtagttgaaaactcactttgggaagcggttccggctttccta
cgtgaatttaatgagcaattagaagactcaattggtgctgaactgcccgtcgaagcaaac
ccaattcgttttacttcttggatgggaggagaccgcgacggtaacccgaatgtgactgcg
gaagtgactcgtcatgtattactacttagccgctggaaagccgcagatctctttttaaaa
gatatccaagtgttggtttctgaactgtccatgaccgaagcgacacctgagttacgggcg
ctcgctgggggagatgaggtagatgaaccttaccgacaaattgcaaaaaatttgcgtagc
caactcttttccacattagagtatttagaacgcaaggtaaaaggcgaacaagcactacca
ccagccgatttactgaccgacaatgcccaattgtgggatccactatatgcctgttatcaa
tcgttaatggcctgtggtatgagcattattgcgaatgggcagttactcgatacgttacgt
cgtatacggagttttggcttgcaactcgttcgcattgacgttcgccaagaaagtactcgc
catacagaagcgcttgctgaattaacgcaatatcttgggttaggggattatgcagcttgg
agtgaagaggaaaaacaagcctttttactgtctgaattacaatctcgtcggccgttgatc
cctcgtcattggcaaccaagccctgaaacggcagaagtatttgaaacttgccgcgtgatc
gcagaatcgaaaaatgactccatcgcagcttacgtcatttcgatggcgaaagttccttcc
gatgttctggccgttaaattgctcctcaaagaggcgggggcatccgttcgcctgcctgtc
gcacctctgtttgaaacacttgaagatttgaataatgctgaaagtgttatgcaaaaactc
ttgagcattgagtggtatcgtgagctgattgatgaccgccaaatggtcatgattggctac
tctgattcggcaaaagatgctggggtgatggcggcatcatgggcgcaatatcgtgcacaa
gatgcgctgattaagttgtgcgacaaagaaggggtcactttaaccttgttccatggacgt
ggaggcactattggccgtggtggtgcgcccgctcattcagcactcttgtcacaaccgcca
ggcagcctgaaagggggattacgagtgactgaacaaggtgaaatgatccgctttaagttt
ggtctaccacaagtggcgattagcagccttgcgctgtatgcaagcgcgattttagaagct
aatttactgccgccaccggagccaaaacaagagtggaaatcagtgatggataccctctct
gacgtttcttgtgcgatgtaccgtgattatgttcgtgagcagcctgattttgtaccttac
ttccgcgctgcaacaccagagctagaattaggcaagttgccgttggggtctcgtccggca
aaacgccgtccaacggggggcgttgagacattacgtgcgatcccatggatttttgcatgg
acacaaaatcgcctcatgttgcctgcttggttaggggcgggagcagcgttaaaatatgtg
attgagaaagaaggcaaacaagccatattagatgaaatgtggcaacaatggccgttcttt
aatacccgtatcgccatgctggaaatggtttatgcgaaggctgacttgtggctggctgaa
tattatgatcaccgtttagtggaggagcgcctttggcctctgggtgtgaaattacgtgag
cagctctctgaagatattaagagtgtgctggcggtgtccaaagatgaagccttaatggca
gacttaccttggattgcggagtcaattgttttacgtaatgtttatacggacccgttaaac
gttttacaggccgagctactacaccgttctcgccagcaagagcatccggatcctcgcgtt
gagcaagcgttgatggtgacgattgcaggtgttgcagcggggatgcgtaataccggctag

DBGET integrated database retrieval system