KEGG   Providencia stuartii MRSN 2154: S70_11240Help
Entry
S70_11240         CDS       T02042                                 

Definition
(GenBank) acetylornithine deacetylase
  KO
K01438  acetylornithine deacetylase [EC:3.5.1.16]
Organism
psi  Providencia stuartii MRSN 2154
Pathway
psi00220  Arginine biosynthesis
psi01100  Metabolic pathways
psi01110  Biosynthesis of secondary metabolites
psi01130  Biosynthesis of antibiotics
psi01210  2-Oxocarboxylic acid metabolism
psi01230  Biosynthesis of amino acids
Module
psi_M00028  Ornithine biosynthesis, glutamate => ornithine
Brite
KEGG Orthology (KO) [BR:psi00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    S70_11240
Enzymes [BR:psi01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.16  acetylornithine deacetylase
     S70_11240
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M28 Peptidase_M42
Motif
Other DBs
NCBI-ProteinID: AFH94098
UniProt: A0A140NN83
LinkDB All DBs
Position
complement(2417347..2418501)
Genome map
AA seq 384 aa AA seqDB search
MNIKLPAFIEIYRQLIATPSISATDAQLDQSNKALVELLGGWLETLGFTVNIQPVPDTRD
KYNLHASIGEGNGGLMLCGHTDTVPFDEGRWSKNPFALSEHDGKLYGLGTADMKGFFAFI
VDALRDIDTRKLTRPLHILATADEETSMAGARYFAASTQLRPDFAIIGEPTSLQPIRAHK
GHISNAIRITGQSGHSSDPERGVNAIELMHESISHLMTLRNTLKERYNNPAFVIPYPTMN
FGHIHGGDAANRICGCCELHMDIRPLPGLTLQDLDELLNETLEPVKARWPGRLTIESLHP
PIPGYECPTDHKMVAVIEQLLGQKAETVNYCTEAPFIQALCPTLVLGPGSIEQAHQPDEF
IDMKFIEPTRQLLSQLIEHFCLTE
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
gtgaatattaaattacctgcatttattgagatttatcgccaattaattgccactccttct
atcagtgctactgatgcgcaactcgatcagagtaataaagccttagtagaattactgggt
ggatggttggaaaccctcggatttacggtcaatattcaacctgtaccggatacccgtgat
aaatacaacctacatgcctcaataggggaaggaaatggcggcctaatgctgtgtgggcat
accgatacagttccttttgatgaagggcgttggagtaaaaacccttttgcgctatcagag
catgacggcaagttatacggtctcggcactgccgacatgaaaggttttttcgctttcatt
gtcgatgccttacgtgacattgatacccgtaaattaactcgcccattgcatatacttgca
accgcagatgaagaaacctcaatggcaggcgcgcgttactttgcagccagtacacaactt
cgtcctgattttgcgattattggggagccgacctcattacaaccgatacgtgcgcacaaa
gggcatatttcgaatgccatccgtattacggggcaatcaggtcattcaagcgacccagaa
agaggcgtgaatgctatcgaattaatgcatgagtctatttcacatctgatgacgctacgt
aatacattgaaagagcgttataacaatcctgcttttgtgatcccttacccgacgatgaat
tttggtcatattcatgggggtgatgcggctaaccgtatttgtggatgctgtgaattacat
atggatattcgtccattgccggggctgaccttgcaagatttggatgagctattaaatgag
acgttggagcctgtaaaagcaagatggccaggacgcttaacaattgagtctctccatccc
cctattcctgggtatgagtgcccaacggatcataaaatggtggctgtgattgaacagtta
ctgggtcagaaagctgagacggtcaactattgcactgaagcgccgtttattcaggcgcta
tgtccgacacttgtgctcggccctggctcgattgagcaagcacatcaacctgatgagttt
atcgatatgaaatttattgaaccgactcgccaactgctcagccaactgatcgaacatttc
tgcctgactgaataa

DBGET integrated database retrieval system