KEGG   Providencia stuartii MRSN 2154: S70_15750Help
Entry
S70_15750         CDS       T02042                                 

Gene name
sdhA
Definition
(GenBank) succinate dehydrogenase flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
psi  Providencia stuartii MRSN 2154
Pathway
psi00020  Citrate cycle (TCA cycle)
psi00190  Oxidative phosphorylation
psi00650  Butanoate metabolism
psi01100  Metabolic pathways
psi01110  Biosynthesis of secondary metabolites
psi01120  Microbial metabolism in diverse environments
psi01130  Biosynthesis of antibiotics
psi01200  Carbon metabolism
Module
psi_M00009  Citrate cycle (TCA cycle, Krebs cycle)
psi_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
psi_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:psi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    S70_15750 (sdhA)
   00650 Butanoate metabolism
    S70_15750 (sdhA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    S70_15750 (sdhA)
Enzymes [BR:psi01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     S70_15750 (sdhA)
    1.3.5.4  fumarate reductase (quinol)
     S70_15750 (sdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C GIDA Pyr_redox_2 HI0933_like Thi4 FAD_binding_3 DAO Pyr_redox_3
Motif
Other DBs
NCBI-ProteinID: AFH94965
UniProt: A0A140NPD0
LinkDB All DBs
Position
3344412..3346178
Genome map
AA seq 588 aa AA seqDB search
MNLPIREFDAIVIGAGGAGMRAALQISQLGLSCALLSKVFPTRSHTVSAQGGITVALGNT
HPDNWEWHMYDTVKGSDYIGDQDAIEYMCKTGPEAILELEHMGLPFSRLDDGRIYQRPFG
GQSKNFGGEQAARTAAAADRTGHALLHTLYQQNLKNHTTIFSEWYALDLVKNQDGDIVGC
TAICMETGELVYFKAKATILATGGAGRIYQSTTNAHINTGDGVGMAARAGVPLQDMEMWQ
FHPTGIAGAGVLVTEGCRGEGGYLLNKDGERFMERYAPNAKDLAGRDVVARSIMIEIREG
RGCDGPWGPHAKLKLDHLGKEVLESRLPGILELSRTFAHVDPIKEPIPVIPTCHYMMGGI
PTKVTGQAIRYNEKGEDEVIPGLFAVGEIACVSVHGANRLGGNSLLDLVVFGRSAGLHLK
ESLMEQGSMREASESDIDAAMARFNRWENARTGEDPVEIRKALQTCMQHNFSVFREGDAM
AKGLEELKVIRERLKNARLDDTSTEFNTQRIECLELDNLMETAYATAQAANFRTESRGAH
SRFDYPDRDDVNWLCHSLYLPQSETMTRREVNMQPKLREPFPPKVRTY
NT seq 1767 nt NT seq  +upstreamnt  +downstreamnt
atgaatctgccaataagagaatttgacgctatcgttatcggtgcaggtggcgcaggtatg
cgcgctgcattgcaaatttcgcaacttggcttatcttgcgccttgttgtcaaaagttttt
ccaacccgttctcatacggtatcagcgcaaggtggtatcactgttgcactaggtaacact
cacccagataactgggagtggcacatgtatgacaccgtaaaagggtctgactatatcggt
gaccaagatgccatcgaatacatgtgtaaaacgggtccagaagcgattcttgaattagaa
catatgggcttaccattctctcgtttggacgacggtcgtatttatcagcgtccattcggt
ggtcagtctaaaaacttcggtggtgagcaagcggctcgtaccgctgctgctgctgaccgt
actggtcatgctctgttgcatacgttgtatcaacaaaacctgaaaaaccacaccactatt
ttttctgagtggtatgcccttgatttagttaaaaaccaagatggcgatatcgttggttgt
acggcaatttgtatggaaactggcgagctagtttacttcaaagctaaagcaacgatcctt
gcaacaggtggtgcaggccgcatctatcaatccacaacaaacgctcacatcaatacgggt
gacggtgttggtatggctgcccgtgcgggtgtgccactacaagatatggaaatgtggcaa
ttccacccaacaggtatcgcaggtgcaggggttctggtaacagaaggctgccgtggtgaa
ggtggatacctattgaataaagacggcgagcgtttcatggagcgttatgcgcctaacgcg
aaagaccttgctggtcgtgacgttgttgctcgttcaattatgattgaaatccgtgaaggc
cgtggctgtgatggcccttggggacctcacgcgaaattgaaattggatcacttgggtaaa
gaagttctggaatcacgcctaccgggtattcttgagttatctcgtacctttgctcacgtt
gacccaatcaaagagccaatcccagttatcccaacgtgtcactatatgatgggaggtatc
ccaactaaggttacaggtcaagcgattcgttataacgaaaaaggcgaggatgaagtcatt
ccaggtctgttcgctgtgggtgaaattgcgtgtgtatctgtacacggtgctaaccgcctt
ggtggtaactcattgctcgacttagtggtatttggtcgttctgcgggtctacacctgaaa
gagtcactgatggagcaaggttcaatgcgtgaagcatctgaatctgacattgatgctgca
atggctcgctttaaccgctgggaaaatgcacgtacgggtgaagatcctgttgaaatccgt
aaagcgctgcaaacctgcatgcaacataacttctcggtattccgtgaaggtgatgcaatg
gcgaaaggtttagaagagctgaaagttatccgcgagcgtttgaaaaatgcacgtcttgat
gacacatcgaccgagttcaacactcaacgtattgaatgtttagagctggataacttgatg
gaaacagcttatgcaacagcacaagctgcaaacttccgtactgaaagtcgcggagcgcat
agccgtttcgactatccagatcgtgatgacgttaattggctgtgtcactcattgtattta
ccgcaatctgaaacgatgacgcgtcgtgaagtgaacatgcaacctaagttgcgtgaaccc
ttcccgccgaaagtacgtacttattaa

DBGET integrated database retrieval system