KEGG   Providencia stuartii MRSN 2154: S70_15755Help
Entry
S70_15755         CDS       T02042                                 

Gene name
sdhB
Definition
(GenBank) succinate dehydrogenase iron-sulfur subunit
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
psi  Providencia stuartii MRSN 2154
Pathway
psi00020  Citrate cycle (TCA cycle)
psi00190  Oxidative phosphorylation
psi00650  Butanoate metabolism
psi01100  Metabolic pathways
psi01110  Biosynthesis of secondary metabolites
psi01120  Microbial metabolism in diverse environments
psi01130  Biosynthesis of antibiotics
psi01200  Carbon metabolism
Module
psi_M00009  Citrate cycle (TCA cycle, Krebs cycle)
psi_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
psi_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:psi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    S70_15755 (sdhB)
   00650 Butanoate metabolism
    S70_15755 (sdhB)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    S70_15755 (sdhB)
Enzymes [BR:psi01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     S70_15755 (sdhB)
    1.3.5.4  fumarate reductase (quinol)
     S70_15755 (sdhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer4_18 Fer4_7 Fer4_9 Fer4
Motif
Other DBs
NCBI-ProteinID: AFH94966
UniProt: A0A140NRZ6
LinkDB All DBs
Position
3346214..3346930
Genome map
AA seq 238 aa AA seqDB search
MKLEFSIYRYNPDVDNAPRMQDYTLEVPEGRDMMLLDALIQLKEKDPTLSFRRSCREGVC
GSDGVNMNGKNGLACITPLSALTRSGKKIVIRPLPGLPVIRDLIIDMSQFYTQYEKIRPY
LINDNKNPPARENLQSPAQREKLDGLYECILCACCSTSCPSFWWNPDKFIGPAGLLAAYR
FLIDSRDTETDARLDDLNDAFSVFRCHSIMNCVNVCPKGLNPTKAIGHIKSMLLKHSA
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
atgaaacttgaattttcgatttatcgctataatccggacgtagataacgcgccacgtatg
caagattacacgctcgaagtgcctgaagggcgtgacatgatgttgctggatgcgttgatc
caactgaaagagaaagatccaacattgtcattccgtcgttcttgccgtgaaggtgtatgt
ggctctgacggcgttaacatgaatggtaaaaatggtctggcttgtatcacacccctgtct
gcgttgactcgtagcggaaagaaaattgtgatccgtccattaccaggtctgcctgttatt
cgtgacctgattatcgacatgagccagttctatactcaatacgaaaaaattcgtccgtat
cttattaatgataataagaacccaccggcgcgtgagaatttacagtcaccggcacagcgt
gaaaaactcgatggattatatgagtgtattttgtgtgcatgttgctcaacttcttgccca
tcgttctggtggaacccggacaaatttattggtccagcaggtcttttagctgcatacagg
ttcctaattgatagtagagatactgaaacagatgctcgattagatgatctgaacgacgct
tttagtgttttccgctgtcatagcatcatgaattgtgtcaatgtatgtcctaaaggacta
aatccaacgaaagctatcgggcatattaaatctatgttactaaaacatagtgcataa

DBGET integrated database retrieval system