KEGG   Providencia stuartii MRSN 2154: S70_19655Help
Entry
S70_19655         CDS       T02042                                 

Definition
(GenBank) enoyl-(acyl carrier protein) reductase
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
psi  Providencia stuartii MRSN 2154
Pathway
psi00061  Fatty acid biosynthesis
psi00780  Biotin metabolism
psi01100  Metabolic pathways
psi01130  Biosynthesis of antibiotics
psi01212  Fatty acid metabolism
Module
psi_M00083  Fatty acid biosynthesis, elongation
psi_M00572  Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP
Brite
KEGG Orthology (KO) [BR:psi00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    S70_19655
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    S70_19655
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    S70_19655
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:psi01004]
    S70_19655
Enzymes [BR:psi01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     S70_19655
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     S70_19655
Lipid biosynthesis proteins [BR:psi01004]
 Fatty acid synthase
  Component type
   S70_19655
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR Polysacc_synt_2
Motif
Other DBs
NCBI-ProteinID: AFH95724
UniProt: A0A140ST59
LinkDB All DBs
Position
complement(4104277..4105065)
Genome map
AA seq 262 aa AA seqDB search
MGFLTGKRILITGVASKLSIAYGIAKAMHEQGAELAFTYQNEKLKPRVEEFAASLNSNIV
LECDVAVDASIDAMFAELGKSWPKFDGFVHSIGFAPADQLDGDYVDAVTRDGFRIAHDIS
AYSFVAMAKACRNMLNPDASLLTLTYLGAERAIPNYNVMGLAKASLEANVRYMANAMGPQ
GIRVNAVSAGPIRTLAASGIKDFRKMLAHCEAVTPIRRTVTIEDVGNTAAFLSSNLAAGI
TGEVVHVDGGFSIAAMNELELK
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgggttttttaaccggcaaacgcattctaatcactggcgttgccagtaaattatcaatt
gcatacggtattgctaaagcaatgcatgaacaaggcgctgaactggcgttcacttatcaa
aacgaaaaattaaaacctcgtgtcgaagagtttgctgcatctttaaactctaacatcgtt
cttgagtgtgatgttgctgttgatgcaagtattgacgctatgtttgctgaattaggaaaa
tcctggcctaaatttgatggctttgtccactcaatcggctttgcaccagcagatcagctt
gacggcgattatgttgacgcggtaacacgtgatggtttccgtatcgctcacgatatcagt
gcatacagttttgttgcgatggcaaaagcatgccgtaacatgctaaacccagatgcttct
ttactgacgcttacctatttaggtgctgagcgcgctattcctaactataacgtaatgggt
cttgctaaagcctctttagaagctaacgttcgttatatggcaaatgcaatgggtcctcaa
ggtatccgtgtcaacgcggtttcagcaggcccaatccgtacactcgcggcatcaggtatc
aaagacttccgtaaaatgctggcacactgcgaagctgtaacgccaattcgtcgtacagtc
actatcgaagacgtgggtaatacagcggcattcctaagctcaaatcttgcagcaggtatt
actggtgaagtcgtacatgttgatggtggtttcagcattgccgcaatgaatgaactggaa
cttaaataa

DBGET integrated database retrieval system