KEGG   Providencia stuartii MRSN 2154: S70_20615Help
Entry
S70_20615         CDS       T02042                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
psi  Providencia stuartii MRSN 2154
Brite
KEGG Orthology (KO) [BR:psi00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    S70_20615
Enzymes [BR:psi01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     S70_20615
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 GIDA HI0933_like FAD_binding_2 FAD_binding_3 AlaDh_PNT_C NAD_binding_8 Thi4 DAO FAD_oxidored NAD_binding_7 Glutaredoxin K_oxygenase FMO-like
Motif
Other DBs
NCBI-ProteinID: AFH95907
UniProt: A0A140STD0
LinkDB All DBs
Position
4304996..4306570
Genome map
AA seq 524 aa AA seqDB search
MLDNNMQAQLKAYLEKLTKPVELVANLDSSNKSNEIKQLLNQIAALSDKITVREVQDNTQ
RVPSFLITNPGVDSGLRFAGSPLGHEFTSLVLALLQIGGHPSKEAQELLDQVKALEGEFH
FETYYSLSCHNCPDVVQALNLMAVLNPNITHTAIDGALFQNEIEERNVMGVPAVFLNGKE
FGQGRMTLSEIINKVDTNADARAAKALTEREPFEVLIIGSGPAGASAAVYTARKGIRTGV
IGERFGGQVMDTVDIENYISVLKTEGAIFAGALKNHVDDYNVDVIDGQSVTKLIPATEEG
GYHQIETASGGVMKSRSIIIATGARWRNMGVPGEQEYRTKGVTFCPHCDGPLFKGKRVAV
IGGGNSGIEAAIDLAGIVEHVTVLEFAPELKADSVLQDKARSLKNVDIIVNAQTLEVKGD
GSKMTGLEYKDRTDDSVHLLEVAGAFVQIGLLPNTNWLGDTVARNRIGEIEVDARGETNV
KGVFAAGDCTTVPYKQIIISAGEGAKAALSAFDYLIRTSTRTAE
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
atgctcgataacaatatgcaagcgcaattgaaagcgtatttagaaaaattgactaaacct
gttgagttagtcgctaatttagatagcagtaataaatcaaatgaaataaaacagcttcta
aaccaaattgctgcgctttcagacaagattactgttcgtgaagtacaagataatactcaa
agagtaccatcatttttaattactaaccctggtgttgatagtggattgcgttttgcaggt
tcaccactaggccatgaatttacatcgcttgtgcttgcattgttgcaaattggtggtcac
ccatctaaagaagcacaagagttattagatcaagtgaaggcccttgaaggggaattccat
tttgaaacctattattcattatcgtgccataactgcccagatgttgtgcaagcactgaat
ttaatggcagtattaaatccaaatatcacacatacagcgattgatggtgcgctgtttcaa
aatgaaattgaagaacgtaatgtgatgggcgttcccgctgttttcctaaatggaaaagag
ttcggccaagggcgcatgacattaagtgagatcattaataaggttgacacgaatgctgac
gcgcgtgccgctaaagcattaacggaacgtgaaccatttgaagtactcatcatcggtagt
ggacctgctggagcatccgcagcggtttatactgcacgtaaaggtattcgcactggtgtg
atcggtgagcgttttggtggccaagttatggataccgttgatatcgaaaactacatttct
gtactcaaaacagaaggggcgatatttgcgggagcactgaagaaccacgttgatgactac
aatgttgatgtaattgatggtcagtcagtgactaagttaattccagcaacagaagaaggc
ggttaccaccaaatcgaaacagcttccggcggagtaatgaagtcacggagtatcattatt
gcgacaggtgcccgttggcgtaacatgggagtacctggggagcaagagtatcgcacgaaa
ggcgttacattctgcccacactgtgatggtccgttgtttaaaggcaaacgcgttgctgtg
attggtggaggtaactcaggtattgaagcagctattgacttagcgggtattgttgaacat
gtaacagtattggaattcgcgcctgaattgaaggcggattcagtactacaagataaagca
cgtagcctgaaaaatgttgacattatcgttaatgctcaaacattggaagtgaagggcgat
ggtagcaagatgacgggtcttgaatataaagaccgtactgatgatagtgtacatttatta
gaagttgcaggcgcatttgtacaaattggcctgttgccaaataccaattggttaggtgat
accgttgcacgtaaccgtataggcgaaattgaggtggatgcacgtggcgaaacaaatgtg
aaaggtgtgttcgctgcgggtgactgtactactgtaccttataaacagatcattatttca
gccggtgaaggtgcaaaagccgcacttagcgcctttgattacctaatccgcacaagtacc
agaaccgctgaataa

DBGET integrated database retrieval system