KEGG   Pseudomonas silesiensis: PMA3_04875Help
Entry
PMA3_04875        CDS       T05412                                 

Definition
(GenBank) 3-hydroxyacyl-[acyl-carrier-protein] dehydratase FabZ
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
psil  Pseudomonas silesiensis
Pathway
psil00061  Fatty acid biosynthesis
psil00780  Biotin metabolism
psil01100  Metabolic pathways
psil01212  Fatty acid metabolism
Module
psil_M00083  Fatty acid biosynthesis, elongation
psil_M00572  Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP
Brite
KEGG Orthology (KO) [BR:psil00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    PMA3_04875
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    PMA3_04875
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:psil01004]
    PMA3_04875
Enzymes [BR:psil01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     PMA3_04875
Lipid biosynthesis proteins [BR:psil01004]
 Fatty acid synthase
  Component type
   PMA3_04875
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA 4HBT MaoC_dehydratas 4HBT_2
Motif
Other DBs
NCBI-ProteinID: ANJ54533
UniProt: A0A191YP27
LinkDB All DBs
Position
1092372..1092812
Genome map
AA seq 146 aa AA seqDB search
MMDINEIREYLPHRYPFLLVDRVVDLDVEGKRIRAYKNVSINEPFFNGHFPAHPIMPGVL
IIEAMAQAAGILGFKMLDVKPADGTLYYFVGSDKLRFRQPVLPGDQLILEARFLSCKRQI
WKFECQASVDGKPVCSAEIICAERKL
NT seq 441 nt NT seq  +upstreamnt  +downstreamnt
atgatggacatcaacgagattcgcgaatacctgcctcaccgttacccgttcctgctggtg
gaccgggtcgtggatctggatgtggaaggcaagcgcattcgcgcctacaagaatgtcagc
atcaacgaacctttcttcaacggtcacttccctgcgcatccaatcatgccgggcgtattg
atcatcgaagcaatggctcaggctgccgggatccttggcttcaaaatgctcgacgtgaaa
cctgccgatggcacgctctattactttgtcggctccgacaagctgcgcttccgccagccg
gtcttgccgggtgatcagctgatcctggaagccaggttcctgagctgcaagcgccagatc
tggaagttcgagtgccaggcttcggtcgatggcaagccagtctgctccgctgaaatcatc
tgcgcggaacgcaaactatga

DBGET integrated database retrieval system