KEGG   Pseudomonas silesiensis: PMA3_08595Help
Entry
PMA3_08595        CDS       T05412                                 

Gene name
fadB
Definition
(GenBank) multifunctional fatty acid oxidation complex subunit alpha
  KO
K01825  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase / enoyl-CoA isomerase [EC:1.1.1.35 4.2.1.17 5.1.2.3 5.3.3.8]
Organism
psil  Pseudomonas silesiensis
Pathway
psil00071  Fatty acid degradation
psil00280  Valine, leucine and isoleucine degradation
psil00281  Geraniol degradation
psil00310  Lysine degradation
psil00362  Benzoate degradation
psil00380  Tryptophan metabolism
psil00410  beta-Alanine metabolism
psil00640  Propanoate metabolism
psil00650  Butanoate metabolism
psil00903  Limonene and pinene degradation
psil00930  Caprolactam degradation
psil01100  Metabolic pathways
psil01110  Biosynthesis of secondary metabolites
psil01120  Microbial metabolism in diverse environments
psil01130  Biosynthesis of antibiotics
psil01200  Carbon metabolism
psil01212  Fatty acid metabolism
Module
psil_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:psil00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    PMA3_08595 (fadB)
   00650 Butanoate metabolism
    PMA3_08595 (fadB)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    PMA3_08595 (fadB)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    PMA3_08595 (fadB)
   00310 Lysine degradation
    PMA3_08595 (fadB)
   00380 Tryptophan metabolism
    PMA3_08595 (fadB)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    PMA3_08595 (fadB)
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    PMA3_08595 (fadB)
   00281 Geraniol degradation
    PMA3_08595 (fadB)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    PMA3_08595 (fadB)
   00930 Caprolactam degradation
    PMA3_08595 (fadB)
Enzymes [BR:psil01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     PMA3_08595 (fadB)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     PMA3_08595 (fadB)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     PMA3_08595 (fadB)
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.8  Delta3-Delta2-enoyl-CoA isomerase
     PMA3_08595 (fadB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 NAD_binding_2
Motif
Other DBs
NCBI-ProteinID: ANJ55213
UniProt: A0A191YR13
LinkDB All DBs
Position
1896435..1898582
Genome map
AA seq 715 aa AA seqDB search
MIYEGKAITVKALESGIVELKFDLKGESVNKFNRLTLNELRQAVDTIKADNSIKGVIVSS
GKDVFIVGADITEFVENFKLPDAELVAGNLEANRIFSDFEDLNVPTVAAINGIALGGGLE
MCLAADYRVMANTAKIGLPEVKLGIYPGFGGTVRLPRIIGADNAIEWIAAGKENRAEDAL
KVGAVDAVVAPEKLLEAALNLVKGAISGEFDYKAKRQPKLEKLKLNAIEQMMSFETAKGF
VAGQAGPNYPAPVEAIKTIQKAANFGRDKALEVEAAGFVKLAKTSAAQSLIGLFLNDQEL
KKKAKAYDEIAKDVKQAAVLGAGIMGGGIAYQSASKGTPILMKDINEHGIEQGLAEAAKL
LVSRVDKGRMTAAKMAEVLNGIRPTLSYGDFGHVDLVVEAVVENPKVKQAVLAEVEGQVK
EDTILASNTSTISITLLAKALKRPENFVGMHFFNPVHMMPLVEVIRGEKSSELAIATTVA
YAKKMGKNPIVVNDCPGFLVNRVLFPYFGGFAKLVSAGVDFVRIDKVMEKFGWPMGPAYL
MDVVGIDTGHHGRDVMAEGFPDRMKDDRRSAVDALYEAKRLGQKNGKGFYAYETDKNGKQ
KKVADPSVADVLKPIVFEQREVTDEDIVNWLMIPLCLETVRCLEDGIVETAAEADMGLVY
GIGFPPFRGGALRYIDSIGVAEFVALADQYADLGALYHPTAKLREMAKTGQRFFG
NT seq 2148 nt NT seq  +upstreamnt  +downstreamnt
atgatttacgaaggtaaagccatcacggttaaggctcttgaaagtggcatcgtcgaattg
aaattcgacctcaagggtgagtccgtcaacaagttcaaccgtctaaccctgaatgaattg
cgtcaggccgtagacaccatcaaggcagataattcgatcaagggtgtgatcgtcagcagt
ggcaaggacgtgttcatcgttggcgccgacatcaccgaatttgtcgagaacttcaagctg
cccgatgcagagcttgtggcaggcaacctcgaagccaacaggatcttcagcgatttcgaa
gacctgaatgtcccgactgtcgccgcgatcaacggcattgccctgggcggcggtctggaa
atgtgcctggcggcggactaccgcgtcatggccaacaccgccaagatcggtctgccggaa
gtcaagctgggcatctatccgggcttcggcggcactgtgcgcctgccgcgcatcatcggt
gccgacaacgccatcgagtggattgccgccggtaaggaaaaccgcgccgaagacgcactg
aaagtcggtgccgtcgacgccgtggtcgccccggagaaactgctggaagccgcactgaac
ctggtcaagggcgccatctccggcgaattcgattacaaggccaagcgtcagccgaagctg
gaaaaactcaagctcaacgccatcgaacaaatgatgtcgttcgagaccgccaaaggtttc
gtcgccggtcaagcgggcccgaactacccggcgccggtcgaagcgatcaagaccatccag
aaagccgcgaacttcggtcgtgacaaggcgctggaagtcgaagccgccggtttcgtcaaa
ctggccaagacctctgccgcgcagagcttgatcggtctgttcctgaacgatcaggaactg
aagaaaaaggccaaggcctacgacgaaatcgccaaggacgtgaagcaggccgccgtgttg
ggcgccggcatcatggggggcggtatcgcttatcagtcggcctccaaaggcacgccgatc
ctgatgaaggacatcaacgagcacggcatcgagcaaggcctggctgaagccgccaagctg
ctggtgagccgcgttgataaaggtcgcatgaccgcggcgaaaatggccgaagtactcaac
ggcattcgtccgaccctgtcctacggtgacttcggtcacgtcgacctggtcgtcgaagcg
gtcgtcgagaaccccaaggtcaagcaagccgtgttggctgaagtggaaggccaggtcaag
gaggacaccatcctcgcgtccaacacctcgaccatttccatcaccttgctggccaaggcc
ctcaagcgtccggaaaacttcgtcggcatgcacttcttcaacccggtgcacatgatgccg
ctggtggaagtgatccgtggcgagaagtccagcgagctggccatcgccaccaccgtggcc
tacgccaagaaaatgggcaagaacccgatcgtcgtcaacgattgcccgggctttctggtc
aaccgcgtgctgttcccgtacttcggcggtttcgccaagctggtcagcgccggtgtggac
ttcgtgcgcatcgacaaggtcatggaaaaattcggctggccgatgggcccggcgtacctg
atggacgtggtcggcatcgacaccggccaccacggtcgcgacgtgatggctgaaggtttc
ccggaccgcatgaaagacgaccgtcgttcggccgtcgacgcgctctacgaagccaagcgc
ctgggccagaagaacggcaagggcttctacgcctacgagaccgacaagaacggcaagcag
aagaaagtcgccgacccgtcggtggcggacgtgctcaagccgatcgtgttcgaacagcgt
gaagtcactgacgaagacatcgtcaactggctgatgatcccgctgtgcctggagaccgtg
cgctgcttggaagacggcatcgtcgagaccgctgccgaagccgacatgggtctggtctac
ggtattggtttccctccattccgcggcggtgcgctgcgctacatcgactcgatcggtgtg
gccgagttcgttgccctggctgaccagtacgctgatttgggcgcgctgtaccacccgacc
gcaaaactgcgtgaaatggccaaaaccggccaacggttcttcggttaa

DBGET integrated database retrieval system