KEGG   Pseudomonas silesiensis: PMA3_09700Help
Entry
PMA3_09700        CDS       T05412                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
psil  Pseudomonas silesiensis
Pathway
psil00473  D-Alanine metabolism
psil01100  Metabolic pathways
psil01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:psil00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    PMA3_09700
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    PMA3_09700
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:psil01011]
    PMA3_09700
Enzymes [BR:psil01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     PMA3_09700
Peptidoglycan biosynthesis and degradation proteins [BR:psil01011]
 Precursor biosynthesis
  Racemase
   PMA3_09700
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: ANJ55403
UniProt: A0A191YRL4
LinkDB All DBs
Position
complement(2114930..2116159)
Genome map
AA seq 409 aa AA seqDB search
MKTTFSHFAAVGFIALGTQAVAAPLLQEYNFKQDVNATISQTNAWLEISKSAFKQNIEFV
KNGLSKGSSLCAVMKADAYGHGIALLIPTIMEAGINCIGIASNEEARIARKEGYTGKIIR
VRQATEGEIVSALPYDIEELIGNVQAALAISTLAEHNGKPIKIHLVTNAGAMSRNGLELA
TEQGKKDVLEITSMKGLKVTGIMTHFAVEDKAFVMEAYDKFMSEQDWIIKTAHLNRDEIT
VHCANSFATLDVPATHLDMVRVGGALYGDLIGRAELKRVMSLKSKVAAVNTYPAGNTVGY
DRTLTLTRDSRLANIPVGYSDGYRRVFTNKSFVVINGVKVPTVGKISMNTAMVDVTDVKN
VKPGDTVTLYGKQGDAEITQAELEDINNGALLADVYTMWGTSNIRILVD
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacaacattttctcactttgccgcagtaggtttcattgcacttggcactcaggct
gtcgctgcaccgctgctacaggagtacaacttcaagcaggacgtaaatgcaacaatatcc
caaacaaacgcctggttagagatcagtaaatctgctttcaagcaaaatatcgaattcgta
aaaaacggattatcgaaaggcagtagcttgtgcgccgtgatgaaagcagatgcttatggc
cacggtatcgcattattgattccgacgatcatggaagcgggcattaattgcatcggcatt
gcgagtaatgaagaagcgcgaattgccagaaaagagggctacacaggaaaaataattcgc
gttcggcaagccacggagggagaaatcgtcagcgcattgccttatgacattgaagagctt
atcggcaatgtacaggcagccctagccatcagcacgctggcagaacacaatggcaagccc
atcaaaattcatctcgttaccaatgcgggcgccatgagcaggaatggcttggagcttgcc
accgagcagggcaaaaaagacgtactggaaatcacctcaatgaagggactgaaggtcacc
gggatcatgacgcacttcgccgtcgaggataaggccttcgtcatggaggcctatgacaag
ttcatgtcggagcaggactggatcatcaagacagcccacttgaaccgtgacgaaatcacc
gttcattgtgccaactcgttcgcaacgcttgacgtcccggcaacgcacttggacatggtg
cgtgtaggaggagcgctttacggtgatttgatcggccgcgccgagctgaaacgcgtcatg
tcactcaaaagcaaggttgctgcggtcaacacctatcctgccggaaacacagtgggttat
gaccgcaccctcacactgactcgagactccaggctcgccaacatcccggtaggttactca
gatggctaccgccgagtgtttaccaacaagtcttttgtcgtcatcaatggcgtgaaagtg
cccacagtcggaaaaatttcgatgaacacggctatggtagatgtgaccgacgtaaaaaac
gtcaagcccggcgataccgtaacgctctatggcaaacaaggcgatgccgagattacacaa
gctgaattggaagacatcaataacggtgcactgctcgccgatgtttacaccatgtggggc
acctcaaacattcgaatactggtcgactaa

DBGET integrated database retrieval system