KEGG   Pimelobacter simplex: KR76_02600Help
Entry
KR76_02600        CDS       T03528                                 

Gene name
tdh
Definition
(GenBank) L-threonine 3-dehydrogenase
  KO
K00060  threonine 3-dehydrogenase [EC:1.1.1.103]
Organism
psim  Pimelobacter simplex
Pathway
psim00260  Glycine, serine and threonine metabolism
psim01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:psim00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    KR76_02600 (tdh)
Enzymes [BR:psim01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.103  L-threonine 3-dehydrogenase
     KR76_02600 (tdh)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 AlaDh_PNT_C 2-Hacid_dh_C ADH_N_2
Motif
Other DBs
NCBI-ProteinID: AIY15924
UniProt: A0A0A1DFC4
LinkDB All DBs
Position
534817..535860
Genome map
AA seq 347 aa AA seqDB search
MFALQKTAPAPGFTPTHDAPVPEPGAGEVLVAVTRAGVCGTDKGIYEWAPWTAGHVTLGT
TVGHEFVGRVAAVGDAVTRVRVGERVSGEGHFACGSCQACRTGHSHVCQEVRILGAGVDG
CFADYVVLPEANVWPVHDAIPDDVAAILDPIGNAMHTVMTAGVAGRSVVVTGAGVIGAIA
IAIARAAGAGTIIATDVSPRRLDLALEMGADHVLPGADPEWPEQARRLVDGGPDVLLEMS
GNPTAIGQGLSSLRCGGTAALLGVPTRPVEIDLLNDVVFKGLTIHGVFGRRMFETWYQVE
NFLLGGRLRLDPVISHRIPLQDYDRAFQLMSSGEAMKIVLVVDADAA
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgttcgccttgcagaagaccgcccccgcgccaggattcacgccgacccacgacgccccc
gtccccgagcccggtgccggcgaggtgctcgtcgcggtcacccgcgccggtgtctgcggc
accgacaaggggatctacgagtgggcgccgtggaccgccggccacgtcacgctggggacg
acggtcggccacgagttcgtcggccgggtcgccgccgtcggggacgccgtcacccgggtg
cgcgtgggggagcgggtcagcggcgagggtcacttcgcctgcgggtcgtgccaggcctgc
cgcaccggccacagccacgtgtgccaggaggtgcgcatcctcggcgccggcgtcgacggc
tgcttcgcggactacgtcgtcctgccggaggcgaacgtgtggccggtccacgacgccatc
cccgacgacgtcgcggcgatcctcgacccgatcggcaacgcgatgcacacggtgatgacc
gcgggcgtcgccggccgcagcgtcgtggtgaccggggccggcgtgatcggcgcgatcgcc
atcgccatcgcccgcgccgcgggggccgggaccatcatcgccaccgacgtcagtccgcgg
cgcctcgacctcgcgctcgagatgggcgccgaccacgtcctgccgggtgcggatccggag
tggcccgagcaggcacgccgcctggtcgacggcggccccgacgtgctgctggagatgagc
ggcaatcccacggcgatcggacagggactgtcgtccctccgctgcggggggaccgccgcg
ctcctcggcgtccccacccggccggtcgagatcgacctgctcaacgacgtggtgttcaag
ggcctcaccatccacggggtgttcggccggcgcatgttcgagacctggtaccaggtcgag
aacttcctgctgggcggccggttgcgcctcgaccccgtcatcagccaccggatccctctc
caggactacgaccgggcgttccagctcatgtcgtccggcgaggcgatgaagatcgtgctc
gtggtcgacgccgacgcggcgtga

DBGET integrated database retrieval system