KEGG   Pimelobacter simplex: KR76_06790Help
Entry
KR76_06790        CDS       T03528                                 

Definition
(GenBank) aldehyde dehydrogenase
Organism
psim  Pimelobacter simplex
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AIY16546
UniProt: A0A0A1DGV6
LinkDB All DBs
Position
1361156..1362613
Genome map
AA seq 485 aa AA seqDB search
MTTLDRDALFIGGTWAAPAADAVLEVVSPHSEEVVARVPEGSTADIDAAVAAARRAFDEG
PWPRMSPAERIDVVQNLSGLYAAKLDEMATIISTEMGSPISFSSLAQAPAPWMQIEAFLG
IAREFPWEERRPGVLGADVVVRHEPVGVVAAIPPWNVPQFTILSKVVPALLAGCTVVVKP
APETPLDGYLLAELLVEAGVPEGVVSIVAGGREVGEHLVRHPGVDKVAFTGSTAAGRKIG
AICGEQLKRVSLELGGKSAAIILDDADEAAAIEGLKFLGVMNSGQACVAQTRVLVSRERH
DAFAASLAAAIGSMKVGDPLDPATEIGPMVAQRQQERVTSYIRIGQEEGAQLLAGGEGRP
DGLDRGWYVRPTVFAGVDNKMRIAQEEIFGPVLSVIAYDDVADAIRIANDSEYGLAGTVW
TADADAGLEVARGVRTGTYGINTYTMDFAAPFGGFKASGLGREFGPEGLAQYTEAKSVYL
SAPPM
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgaccaccctcgaccgcgacgccctcttcatcggtggcacctgggccgcgcccgccgcc
gatgccgtgctggaggtggtctcgccgcactccgaggaggtcgtcgcacgggtccccgag
ggctcgaccgccgacatcgacgccgccgtcgccgccgcgcgccgggcgttcgacgagggg
ccgtggccgcggatgagcccggccgagcggatcgacgtcgtccagaacctgtcgggcctg
tacgccgccaagctcgacgagatggcgaccatcatctccaccgagatgggctcgccgatc
tcgttcagctcgctggcccaggcgcccgcgccgtggatgcagatcgaggcgttcctcggc
atcgcgcgcgagttcccctgggaggagcggcgccccggcgtgctcggcgcggacgtcgtc
gtgcggcacgagccggtcggcgtcgtcgcggcgattccgccgtggaacgtcccgcagttc
acgatcctgtccaaggtcgtcccggcgctgctcgccggctgcaccgtcgtcgtgaagccg
gcgccggagaccccgctcgacggctacctgctcgccgagctgctggtcgaggccggcgtc
cccgagggcgtcgtgtcgatcgtcgccggcggccgcgaggtgggggagcacctggtgcgc
caccccggcgtcgacaaggtcgcgttcaccggatccaccgccgccgggcgcaagatcggc
gcgatctgcggcgagcagctcaagcgggtctcgctcgagctcggcggcaagtccgccgcc
atcatcctggacgacgccgacgaggccgccgcgatcgagggcctgaaattcctcggcgtg
atgaactccggacaggcctgcgtcgcccagacccgcgtcctggtctcgcgcgagcggcac
gacgcgttcgccgcctcgctggcggcggcgatcgggtccatgaaggtgggcgacccgctc
gaccccgcgaccgagatcggcccgatggtcgcgcagcgccagcaggagcgcgtgacgtcg
tacatccggatcgggcaggaggagggcgcccagctgctcgccggcggcgaaggccgcccc
gacggcctcgaccgcggctggtacgtccggcccaccgtcttcgcgggggtcgacaacaag
atgcggatcgcccaggaggagatcttcggcccggtcctgtcggtcatcgcctacgacgac
gtcgcggacgcgatccggatcgccaacgactccgagtacggcctggccggcaccgtctgg
accgccgacgccgacgcggggctcgaggtcgcccgcggggtgcgcaccggcacctacggc
atcaacacctacacgatggacttcgcggcgccgttcggtgggttcaaggcgtcgggactc
gggcgggagttcgggccggaggggctcgcgcagtacacggaggcgaagtcggtgtacctg
tcggcgccgccgatgtag

DBGET integrated database retrieval system