KEGG   Pimelobacter simplex: KR76_09225Help
Entry
KR76_09225        CDS       T03528                                 

Definition
(GenBank) ATP-dependent DNA ligase
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
psim  Pimelobacter simplex
Pathway
psim03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:psim00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    KR76_09225
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:psim03400]
    KR76_09225
Enzymes [BR:psim01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     KR76_09225
DNA repair and recombination proteins [BR:psim03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     KR76_09225
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_primase_S
Motif
Other DBs
NCBI-ProteinID: AIY16897
UniProt: A0A0A1DJT5
LinkDB All DBs
Position
1882124..1883041
Genome map
AA seq 305 aa AA seqDB search
MPKKPEHPQTEVHVDVEGRTMRLTNLQKVLYPSTGTTKGEVLDYYVRVAPVLIPHLVGRP
VTRIRWPHGVGDMSFFEKNAPAGTPSWVRTAEVPTTGSRGPSRHGDTLVFPIIDQLPTLV
WAVNLAALELHVHQWTVDDDGDPVGADRIVIDLDPGEPAGLHECCQVALLVREALAERGY
DALPVTSGSKGLHLYAPLAEALPSSETSEIAKEIAEELAAAHPQQVTATMTKARRRGKVF
LDWSQNAGSKTTVAPYSLRGTTRPQVATPIDWDEVAAGADDPLGLEQFSPSQVLARVEEY
GDLFS
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgccgaagaagcccgagcacccccagaccgaggtccacgtcgacgtcgagggccgcacg
atgcggctgaccaacctccagaaggtgctctacccgagcaccggcaccaccaagggcgag
gtgctcgactactacgtgcgggtcgcgcccgtcctgatcccgcacctggtgggacgcccg
gtcacccggatccgctggccgcacggcgtcggcgacatgagcttcttcgagaagaacgcg
ccggccggaacccccagctgggtgcgcaccgccgaggtgccgaccaccggcagccgcggg
ccgagccggcacggcgacaccctcgtcttcccgatcatcgaccagctcccgaccctggtc
tgggcggtcaacctggccgcgctcgagctgcacgtgcaccagtggaccgtcgacgacgac
ggcgatccggtcggcgccgaccggatcgtgatcgacctcgaccccggcgagcccgccggc
ctccacgagtgctgccaggtcgcgctcctggtgcgcgaggccctcgccgagcgcgggtac
gacgccctgccggtcaccagcggcagcaagggactgcacctctacgcgccactcgccgag
gcgctgccgtcgtccgagacgagcgagatcgccaaggagatcgccgaggagctcgccgcc
gcccacccccagcaggtcaccgccacgatgaccaaggcccggcgccgcgggaaggtcttc
ctcgactggtcgcagaacgcgggctcgaagaccaccgtggcgccctactccctgcggggg
acgacacggccccaggtggcgaccccgatcgactgggacgaggtggccgccggcgccgac
gacccgctcgggctcgagcagttctcgccgtcccaggtgctcgcccgggtcgaggagtac
ggcgacctgttcagctag

DBGET integrated database retrieval system