KEGG   Pimelobacter simplex: KR76_10270Help
Entry
KR76_10270        CDS       T03528                                 

Definition
(GenBank) superoxide dismutase
  KO
K00518  nickel superoxide dismutase [EC:1.15.1.1]
Organism
psim  Pimelobacter simplex
Brite
KEGG Orthology (KO) [BR:psim00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    KR76_10270
Enzymes [BR:psim01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     KR76_10270
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Ni
Motif
Other DBs
NCBI-ProteinID: AIY17038
UniProt: A0A0A1DKG5
LinkDB All DBs
Position
complement(2116465..2116878)
Genome map
AA seq 137 aa AA seqDB search
MFSRLTTLLVAPTVEVSAHCDLPCGVYDPAQARIEAESVKAVIAKALDSDDPDFRTRAIL
IKEQRSELVKHHLWVLWTDYFKPPHFEKYPQLHTLVNEATKLAGATGTKGTLDAAKADEL
LAKIDEIAEIFWETKKA
NT seq 414 nt NT seq  +upstreamnt  +downstreamnt
atgttctcgcgtctcaccacgctgctcgtggccccgaccgtcgaggtctccgcccactgc
gacctgccctgcggcgtctacgaccccgcccaggcccgcatcgaggccgagtcggtcaag
gccgtcatcgccaaggccctcgacagcgacgaccccgacttccgcacccgagcgatcctc
atcaaggagcagcgctccgagctggtcaagcaccacctctgggtgctgtggaccgactac
ttcaagcccccgcacttcgagaagtacccccagctccacacgctggtcaacgaggccacc
aagctggccggcgccaccggcaccaagggcaccctcgacgcggccaaggccgacgagctc
ctcgccaagatcgacgagatcgccgagatcttctgggagaccaagaaggcctga

DBGET integrated database retrieval system