KEGG   Pimelobacter simplex: KR76_10350Help
Entry
KR76_10350        CDS       T03528                                 

Gene name
kgd
Definition
(GenBank) alpha-ketoglutarate decarboxylase
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
psim  Pimelobacter simplex
Pathway
psim00020  Citrate cycle (TCA cycle)
psim00310  Lysine degradation
psim00380  Tryptophan metabolism
psim01100  Metabolic pathways
psim01110  Biosynthesis of secondary metabolites
psim01120  Microbial metabolism in diverse environments
psim01130  Biosynthesis of antibiotics
psim01200  Carbon metabolism
Module
psim_M00009  Citrate cycle (TCA cycle, Krebs cycle)
psim_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:psim00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    KR76_10350 (kgd)
  Amino acid metabolism
   00310 Lysine degradation
    KR76_10350 (kgd)
   00380 Tryptophan metabolism
    KR76_10350 (kgd)
Enzymes [BR:psim01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     KR76_10350 (kgd)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: E1_dh 2-oxoacid_dh Transket_pyr OxoGdeHyase_C 2-oxogl_dehyd_N
Motif
Other DBs
NCBI-ProteinID: AIY19850
UniProt: A0A0A1DWM0
LinkDB All DBs
Position
complement(2131351..2135088)
Genome map
AA seq 1245 aa AA seqDB search
MTQSSDQSTGSPVPADFGANEWLVEEMKERFEADPGSVDAAWAAFFKNNGATAANGTTAT
ATTTATTTATAAAPAAAAPAAPAAPAAPAAPTPKATPAPQVSPASTTTPTPPKADAPKPT
PKDAPRPAPVTASDEPTLTVLRGIPAATAKNMDISLSVPTATSVRNIPVKLLWDNRIVIN
SHLKRARGGKVSFTHLIGYAIVKAIKALPAMNNTFDEIDGKPTMVTPAHINLGLAIDQQK
KDGTRQLVAPSIKACESMDFAQFWTAYEEIVRKAKDNKLTMEDYSGTTVSLTNVGGLGTN
NSVPRLMQGQAAIIGVGSMDYPPEFQGASDETIARNAISRIMTMTSTYDHRVIQGAQSGE
FLGQVHRYLLGEDGFYDEIFRALRIPYEPIRWNNDIATSHDDEIDKQARILELIHAYRVR
GHLMADTDPLEYKQRSHPDLRIESHGLTLWDLDREFPTGSFGGGDRRFMKLRHILGILRD
SYCRTTGIEYMHIMDPEQRRWIQERVEQPHSKPPREEQLRILLKLNQAEAFETFLQTKFV
GQKRFSLEGGETTVPVVDEIAEAAAQAGLDEVTIGMAHRGRLNILANIVGKSYNQIFREF
EGNIDPRTVQGSGDVKYHLGAEGAFVAGTGETIKVSVAANPSHLETVDPVLEGIARAKQD
VLNRGQEFPVLPLLLHGDAAFAGQGVVAETLNLSQLRGYRTGGTVHLVINNQVGFTTSPG
SSRSTLYATDVARMIQAPIFHVNGDDPEACIRVARLAFEYRQAFHSDVVIDLVCYRRRGH
NEGDDPSYTQPLMYDLIEQKRSVRKLYTESLIGRGDITIEEAEQVLRDYQQQLERVFTEV
REASTAPKEWTTVPDYPDKTAGETQTAVSAEVLKRIADAYVTPPDGFTVHPKVMPQLQRR
AAAIADGPIDWGTGEILAFGSLLMEGRPVRLAGQDSRRGTFVSRFATIIDRHNADEWTPL
ANLTEDQAKFFVYDSLLSEYAALGFEYGYSVARPDALVLWEAQFGDFVNGAQSVIDEYIS
AGKTKWGQDSGVVLLLPHGYEGQGADHSSARIERFLTLCADDAMLVAQPSTPASYFHLLR
RHSLGGEHKPLIVFTPKSMLKRKEAASHPADFTSGDFRPVIGDAAAEPGKVSTVLLVSGR
LTWDLMVERKKSERDDVAILRVEQLYPWPIEEIKAELAKYPDARVKWVQDEPFNQGPWPS
YHLNVVPELGRAVEPVTRAASSTTAVGTIKRHAAEQADLIERAFA
NT seq 3738 nt NT seq  +upstreamnt  +downstreamnt
gtgacgcagtcgtcagaccagtccaccggatcacccgttcctgcggacttcggagccaac
gagtggctcgtggaggagatgaaggagcggttcgaggccgaccccggcagcgtcgatgcc
gcctgggccgccttcttcaagaacaacggcgccacggccgccaacgggacgacggcgacg
gccaccacgacggccaccacgacggccaccgcggccgcgcccgccgccgcggccccggca
gcgccggccgccccggccgccccggccgcccccacgccgaaggcgacccccgctccccag
gtcagccctgcctccacgacgacgcccacgccgcccaaggccgacgcgcccaagcccacc
cccaaggacgccccgcgtcccgcgccggtcaccgccagcgacgagccgacgctgaccgtg
ctccgcggcatcccggccgccacggccaagaacatggacatctcgctgtcggtcccgacg
gcgacctcggtgcgcaacatcccggtcaagctcctgtgggacaaccgcatcgtcatcaac
agccacctcaagcgcgcccgcggcggcaaggtgtcgttcacccacctcatcggctacgcg
atcgtcaaggcgatcaaggcgctgccggcgatgaacaacaccttcgacgagatcgacggc
aagccgaccatggtgacgccggcccacatcaacctgggcctggccatcgaccagcagaag
aaggacggcacccgccagctggtcgcccccagcatcaaggcgtgcgagtcgatggacttc
gcgcagttctggacggcgtacgaggagatcgtgcgcaaggccaaggacaacaagctgacc
atggaggactactccggcacgacggtcagcctcaccaacgtcggcggcctcggcaccaac
aactcggtgccgcgcctcatgcagggtcaggccgccatcatcggcgtcggctcgatggac
tacccgccggagttccagggcgcctccgacgagacgatcgcgcgcaacgcgatctcgcgg
atcatgacgatgacctcgacctacgaccaccgcgtcatccagggcgcgcagtcgggcgag
ttcctcggtcaggtgcaccgctacctgctgggtgaggacggcttctacgacgagatcttc
cgcgcgctgcgcatcccgtacgagccgatccgctggaacaacgacatcgcgacctcgcac
gacgacgagatcgacaagcaggcgcgcatcctcgagctgatccacgcctaccgcgtgcgc
ggccacctgatggccgacaccgacccgctcgagtacaagcagcgcagccaccccgacctg
cgcatcgagtcgcacggcctgaccctgtgggacctcgaccgcgagttcccgaccggctcg
ttcggcggcggcgaccggcgcttcatgaagctgcgccacatcctcggcatcctgcgcgac
tcctactgccgcaccaccggcatcgagtacatgcacatcatggaccccgagcagcgccgc
tggatccaggagcgggtcgagcagccgcacagcaagccgccccgcgaggagcagctgcgg
atcctgctgaagctcaaccaggccgaggccttcgagaccttcctgcagaccaagttcgtc
ggccagaagaggttctcgctcgagggcggcgagacgaccgtcccggtcgtcgacgagatc
gccgaggcagccgcgcaggccggcctcgacgaggtcaccatcggcatggcccaccgcggc
cggctcaacatcctcgccaacatcgtcggcaagtcctacaaccagatcttccgcgagttc
gagggcaacatcgacccgcgcacggtccagggctccggcgacgtgaagtaccacctgggc
gccgagggcgccttcgtggccggcaccggcgagaccatcaaggtctccgtcgccgcgaac
ccgtcgcacctcgagacggtcgacccggtcctcgagggcatcgcgcgcgccaagcaggac
gtgctcaaccgcggccaggagttcccggtgctgccgctgctcctgcacggcgacgccgcg
ttcgccggccagggcgtggtcgccgagacgctcaacctctcgcagctgcgcggctaccgc
accggcggcacggtccacctggtcatcaacaaccaggtcggcttcaccacctcgccgggc
tcgtcgcgctcgaccctctacgccaccgacgtggcccggatgatccaggcgcccatcttc
cacgtcaacggcgacgaccccgaggcgtgcatccgcgtcgcgcggctggccttcgagtac
cgccaggccttccacagcgacgtcgtcatcgacctcgtctgctaccgccgccgcgggcac
aacgagggcgacgacccgtcgtacacgcagccgctgatgtacgacctgatcgagcagaag
cggtcggtgcgcaagctctacaccgagtcgctgatcggtcgtggcgacatcacgatcgag
gaggccgagcaggtcctgcgcgactaccagcagcagctggagcgggtcttcaccgaggtc
cgcgaggcgtccacggcgcccaaggagtggaccacggtccccgactacccggacaagacg
gcgggcgagacccagacggccgtgtcggccgaggtgctcaagcgcatcgccgacgcctac
gtcaccccgcccgacggcttcaccgtccacccgaaggtgatgccgcagctgcagcgtcgc
gccgcggccatcgccgacggcccgatcgactggggcaccggcgagatcctcgccttcggc
tcgctgctcatggagggccgcccggtccgcctggccggccaggactcgcgccgcggcacg
ttcgtgtcccgcttcgcgacgatcatcgaccggcacaacgccgacgagtggacgccgctg
gccaacctcaccgaggaccaggcgaagttcttcgtctacgacagcctgctctccgagtac
gccgccctcggcttcgagtacggctactcggtggcgcgtcccgacgcgctggtgctgtgg
gaggcgcagttcggcgacttcgtcaacggcgcccagtcggtcatcgacgagtacatctcc
gcgggcaagaccaagtggggccaggactccggcgtggtgctcctgctcccccacggctac
gagggccagggcgccgaccactcgtcggcgcgcatcgagcgcttcctcacgctgtgcgcg
gacgacgccatgctcgtcgcccagccgtcgaccccggcttcgtacttccacctgctgcgc
cgccactccctcggcggcgagcacaagccgctcatcgtcttcaccccgaagtcgatgctc
aagcgcaaggaggcggcctcgcaccccgccgacttcaccagcggcgacttccgcccggtg
atcggcgacgccgcggccgagccgggcaaggtctccacggtgctgttggtctccggccgg
ctcacctgggacctcatggtcgagcgcaagaagagcgagcgcgacgacgtcgcgatcctg
cgcgtcgagcagctctacccgtggccgatcgaggagatcaaggccgagctcgcgaagtac
ccggacgcccgggtcaagtgggtccaggacgagcccttcaaccagggcccgtggccgtcg
taccacctcaacgtggtgcccgagctcggccgcgcggtcgagccggtcacccgggcggcc
tcctccaccaccgcggtcggcacgatcaagcggcacgcggcggagcaggcggacctgatc
gagcgcgcgttcgcctga

DBGET integrated database retrieval system