KEGG   Pimelobacter simplex: KR76_11865Help
Entry
KR76_11865        CDS       T03528                                 

Definition
(GenBank) inositol-phosphate phosphatase
  KO
K01092  myo-inositol-1(or 4)-monophosphatase [EC:3.1.3.25]
Organism
psim  Pimelobacter simplex
Pathway
psim00521  Streptomycin biosynthesis
psim00562  Inositol phosphate metabolism
psim01100  Metabolic pathways
psim01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:psim00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    KR76_11865
  09110 Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    KR76_11865
Enzymes [BR:psim01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.25  inositol-phosphate phosphatase
     KR76_11865
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Inositol_P
Motif
Other DBs
NCBI-ProteinID: AIY17277
UniProt: A0A0A1DKU5
LinkDB All DBs
Position
2447743..2448534
Genome map
AA seq 263 aa AA seqDB search
MTGPAGLRGLAEDVAGEAAALVREHAGRGVAVAATKSSEVDVVTAADRASEELIRRLILE
ARPGDGFLGEEGDDVTGTSGVRWIVDPIDGTVNFLYGLPEYAVSVAAEVDGEVVAGVVVD
VAKQVVYAGHRGGAATRNGRPIAARGPAPLAHRLVATGFNYTRPVRTVQAAAAARLLPEI
RDLRRTGSCALDLCRVAEGALDGYVEEGVHLWDHAAGGLIAQLAGARLLVTVGAAGTEAV
VCGPEHGFDELLSAVRTAGFLRE
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgaccggaccggccgggctgcgcgggctcgccgaggacgtcgccggcgaggccgccgcg
ctggtccgcgagcatgccggccgaggagtcgcggtcgcggccaccaagtccagcgaggtc
gacgtcgtcaccgcggccgaccgggccagcgaggagctgatccggcggctcatcctcgag
gcccgtcctggtgacggcttcctgggagaggagggcgacgacgtcaccggcacctccggg
gtgcgctggatcgtcgacccgatcgacggcacggtgaacttcctctacggcctgcccgag
tacgccgtctccgtcgccgccgaggtcgacggcgaggtcgtggccggtgtggtcgtcgac
gtcgccaagcaagtggtctatgccggtcaccgcgggggcgcggcgacccggaacggccgg
ccgatcgccgcccgcgggccggcgccgctggcccaccgcctcgtcgcgaccggcttcaac
tacacccggccggtgcggacggtccaggccgctgccgccgctcggctgctgcccgagatc
cgcgacctgcgccggaccggctcgtgcgcgctcgacctgtgccgggtggccgagggcgcc
ctggacgggtacgtcgaggagggggtccacctgtgggaccacgccgccggcgggctcatc
gcgcagctcgccggggcccgcctcctggtgaccgtcggggcggccgggaccgaggccgtg
gtgtgtggcccggagcacggtttcgacgagctcctgtccgccgtgcggacggccggcttc
ctgcgggaatag

DBGET integrated database retrieval system