KEGG   Pimelobacter simplex: KR76_14360Help
Entry
KR76_14360        CDS       T03528                                 

Definition
(GenBank) enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
psim  Pimelobacter simplex
Pathway
psim00071  Fatty acid degradation
psim00280  Valine, leucine and isoleucine degradation
psim00281  Geraniol degradation
psim00310  Lysine degradation
psim00360  Phenylalanine metabolism
psim00362  Benzoate degradation
psim00380  Tryptophan metabolism
psim00410  beta-Alanine metabolism
psim00627  Aminobenzoate degradation
psim00640  Propanoate metabolism
psim00650  Butanoate metabolism
psim00903  Limonene and pinene degradation
psim00930  Caprolactam degradation
psim01100  Metabolic pathways
psim01110  Biosynthesis of secondary metabolites
psim01120  Microbial metabolism in diverse environments
psim01130  Biosynthesis of antibiotics
psim01212  Fatty acid metabolism
Module
psim_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:psim00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    KR76_14360
   00650 Butanoate metabolism
    KR76_14360
  09103 Lipid metabolism
   00071 Fatty acid degradation
    KR76_14360
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    KR76_14360
   00310 Lysine degradation
    KR76_14360
   00360 Phenylalanine metabolism
    KR76_14360
   00380 Tryptophan metabolism
    KR76_14360
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    KR76_14360
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    KR76_14360
   00281 Geraniol degradation
    KR76_14360
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    KR76_14360
   00627 Aminobenzoate degradation
    KR76_14360
   00930 Caprolactam degradation
    KR76_14360
Enzymes [BR:psim01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     KR76_14360
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: AIY17646
UniProt: A0A0A1DJR3
LinkDB All DBs
Position
2931168..2931929
Genome map
AA seq 253 aa AA seqDB search
MTVTSELRPDGIRVVTMNAPPVNALTVQGWFDVAAALDEASADMATKVVVLRAEGKGFNA
GVDIKEMQNTTGFEALLGANRGCFAAFKAVYECSVPVVAAVNGFCVGGGVGLVGNADIVV
ASEDAYFGVPEVNQGALGAATHMARLVPQHMMRTLYFTARTIPAKDLVQFGSVLEVVPRE
DLLDAALKVAGEIAAKNTKVIRAAKEALNGIDPIDVNKSYRWEQGFTFELNLMGVSDELR
DDFAGTTKAGGAQ
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgacagtcaccagcgagttgcgaccggacggcatccgcgtcgtcacgatgaacgctccc
ccggtcaacgccctcaccgtgcagggctggttcgacgtggcggccgccctcgacgaggcg
agcgccgacatggccacgaaggtcgtcgtcctccgcgcggagggcaagggcttcaacgcc
ggcgtcgacatcaaggagatgcagaacacgaccggcttcgaggcgctcctcggtgccaac
cggggctgcttcgccgcgttcaaggctgtctacgagtgctcggtcccggtcgtcgcggcg
gtcaacggcttctgcgtcggcggcggcgtcggcctggtcggcaatgccgacatcgtcgtc
gccagcgaggacgcctacttcggcgtccccgaggtcaaccagggggccctcggcgcggcc
acccacatggcgcgcctcgtcccccagcacatgatgcgcacgctctacttcaccgcgcgc
accatcccggccaaggacctcgtccagttcggctcggtgctcgaggtcgtcccgcgcgag
gacctgctcgacgccgctctcaaggtggccggcgagatcgccgccaagaacaccaaggtc
atccgcgccgccaaggaggcgctcaacgggatcgacccgatcgacgtcaacaagtcctac
cgctgggagcagggcttcacgttcgagctcaacctgatgggcgtcagcgacgagctccgt
gacgacttcgccggcaccaccaaggcaggaggcgcccagtga

DBGET integrated database retrieval system