KEGG   Pimelobacter simplex: KR76_14730Help
Entry
KR76_14730        CDS       T03528                                 

Definition
(GenBank) chorismate synthase
  KO
K01736  chorismate synthase [EC:4.2.3.5]
Organism
psim  Pimelobacter simplex
Pathway
psim00400  Phenylalanine, tyrosine and tryptophan biosynthesis
psim01100  Metabolic pathways
psim01110  Biosynthesis of secondary metabolites
psim01130  Biosynthesis of antibiotics
psim01230  Biosynthesis of amino acids
Module
psim_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:psim00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    KR76_14730
Enzymes [BR:psim01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.5  chorismate synthase
     KR76_14730
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Chorismate_synt
Motif
Other DBs
NCBI-ProteinID: AIY17706
UniProt: A0A0A1DJW8
LinkDB All DBs
Position
complement(2998438..2999616)
Genome map
AA seq 392 aa AA seqDB search
MLRWLTAGESHGPSLVAILEGLPAHVEVTTDDISDALARRRLGYGRGARMKFEADEVTVT
GGVRHGRTQGGPVAIQVGNTEWPKWETVMSADPVDPAVLEAQARNAALTRPRPGHADLAG
MQKYDFADARPILERASARETAARVALGRVASNFLEQATGARIVSHVLEIGGVRTPSAEL
PAPDDVARLDADPVRCLDADGSKQMVERIDQAHKDGDTLGGVVEVVVHGLPPGLGSHVHW
DRRLDARLAGALMGIQAIKGVEVGDGFELAATPGSLAHDEIVPTEDGLRRVSGRSGGTEG
GMTTGEILRVRAAMKPIATVPRALRTVDLATGEEAVAHHQRSDVCAVPAAGIVAEAMVAL
VLAEAVLEKFGGDSVQETRRNVQSYLDTLRFK
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgttgcgctggctgaccgcgggggagtcccacggcccctccctggtcgcgatcctcgag
ggcctgccggcccacgtcgaggtcacgaccgacgacatctccgatgccctggcccgccgt
cgtctcggctacggccgcggcgcacggatgaagttcgaggccgacgaggtcaccgtcacc
ggtggcgtccggcacggccggacccagggcggaccggtcgcgatccaggtcggcaacacc
gagtggcccaagtgggagaccgtgatgtcggccgacccggtcgaccccgccgtcctcgag
gcccaggcgcgcaacgccgcgctcacccgcccccgcccgggccacgccgacctcgccgga
atgcagaagtacgacttcgccgacgcccgcccgatcctcgagcgggcctcggcccgcgag
accgccgcccgggtcgcgctcggccgggtggccagcaacttcctcgagcaggcgaccgga
gcccggatcgtcagccacgtgctcgagatcggcggcgtccgcacgccgtccgccgagctg
cccgcgcccgacgacgtcgcccgcctcgacgccgacccggtccgctgcctcgacgccgac
ggctcgaagcagatggtcgagcggatcgaccaggcccacaaggacggcgacacgctcggc
ggggtcgtcgaggtcgtcgtccacgggctgcccccgggcctcggatcgcacgtgcactgg
gaccgccgcctcgacgcgcggctggccggtgcgctcatgggcatccaggcgatcaagggc
gtcgaggtcggcgacggcttcgagctcgccgccacccccggctcgctcgcgcacgacgag
atcgtccccaccgaggacggcctgcgccgggtctcgggtcgctccggcggcaccgagggc
ggcatgaccaccggcgagatcctccgcgtccgcgcggcgatgaagccgatcgccacggtc
ccgcgggcgctgcgcaccgtcgacctcgccaccggcgaggaggccgtcgcccaccaccag
cgctccgacgtctgcgcggtccccgcggccggcatcgtcgccgaggcgatggtggcgctg
gtcctcgccgaggccgtgctcgagaagttcggcggcgactcggtgcaggagacccgccgc
aacgtgcagtcctacctcgacacgctccggttcaagtga

DBGET integrated database retrieval system