KEGG   Pimelobacter simplex: KR76_21640Help
Entry
KR76_21640        CDS       T03528                                 

Definition
(GenBank) ATP-dependent DNA ligase
Organism
psim  Pimelobacter simplex
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C RNA_ligase
Motif
Other DBs
NCBI-ProteinID: AIY18729
UniProt: A0A0A1DMY9
LinkDB All DBs
Position
4382440..4383555
Genome map
AA seq 371 aa AA seqDB search
MDLPVLPPVLPMLAKAVSGVPDPAKYDAQGLSFEPKWDGFRCIVFRDGDEVELASRNTKP
LTRYFPELVAAMRAELPERCVLDGEIFVAQAGADGKGRLQFEVLQERIHPAASRINLLAE
QTPADFVAFDLLALGDESYVDRPFAERRAALEEALGHLGAATGGRCHLTRTSTDPAVAEE
WFHQFEGAGLDGVVAKPLSAPYAPNARTMLKIKHERTADVVLAGFREHKTSTPENPLIGS
LLLGLYDGGELQHIGVSASFTAQRRAELWHELQSLVVPIEEHPWGRWQEFLVANPGRQPG
TQSRWSQGKDLSFTPLRPDRVIEVKYDAMEGRRFRHTAHFKRWRDDRDPESCGYDQLEQP
VRYDLADVLGG
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
gtggacctccccgtgctgccgcccgtcctgccgatgctcgccaaggccgtgtccggcgtc
cccgacccggccaagtacgacgcgcagggactcagcttcgagcccaagtgggacggcttc
cgctgcatcgtgttccgcgacggcgacgaggtggagctggcgagccggaacaccaagccg
ctgacgcgctacttccccgagctggtggcggcgatgagggccgagctgcccgagcggtgc
gtgctcgacggtgagatcttcgtggcgcaggcgggggcggacggcaagggacggctgcag
ttcgaggtgctgcaggagcggatccacccggcggcgtcgcggatcaacctcctggccgag
cagacgccggcggacttcgtcgcgttcgacctgctggccctcggcgacgagtcgtacgtc
gaccgcccgttcgccgagcgccgcgctgcgctcgaggaggccctcggccacctgggcgcc
gccaccggcggccggtgccacctgacccgcacgagcaccgatcccgcggtggccgaggag
tggttccaccagttcgagggcgccgggctcgacggggtggtggcgaagccgctgagcgcg
ccgtacgcccccaatgcccggacgatgctcaagatcaagcacgagcggacggcggacgtg
gtgctcgccggcttccgcgagcacaagacgagcacgccggagaacccgctgatcggcagc
ctcctcctcggcctgtacgacggcggcgagctgcagcacatcggtgtcagcgcgtccttc
accgcccagcgccgcgccgagctgtggcacgagctgcagtcgctcgtcgtccccatcgag
gagcacccgtggggccgctggcaggagttcctggtggccaacccgggccgccagccgggc
acccagagccggtggagccagggcaaggacctgtcgttcacgccgctgcggcccgaccgc
gtcatcgaggtcaagtacgacgccatggagggccgccgcttccggcacacggcccacttc
aagcggtggcgcgacgaccgcgaccccgagtcgtgcgggtacgaccagctggagcagccg
gtgcgctacgacctggcggacgtcctcggggggtga

DBGET integrated database retrieval system