KEGG   Pimelobacter simplex: KR76_22365Help
Entry
KR76_22365        CDS       T03528                                 

Definition
(GenBank) aldehyde dehydrogenase
Organism
psim  Pimelobacter simplex
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AIY20118
UniProt: A0A0A1DU83
LinkDB All DBs
Position
complement(4531873..4533318)
Genome map
AA seq 481 aa AA seqDB search
MTDRPELFIGGTWQAPRGGEVIEVRNPATRALVGRAALASPADVDAAVGAARTSFDSGVW
SRATPEERAAVLHRAADHLEKRAADLAVSITSELGCPLWFSEMAHVPNPIRHTRYYADHA
RTFAYDEVRSDGRNASLVTQEPVGVVAAITPWNGPLSTPSLKIAPALAAGCSVVLKPPPE
TPLTAYAFADALLEAGLPEGVLSIIPGDREAGAHLVEHADVDKIAFTGSSLAGKQIMATA
AQRVARVTLELGGKSAAIVLDDADISAVVPALLPMAMMVNGQACIAQTRVLVPRSRQKEL
VDALADAMAAQKVGDPMAADTKIGPMVSERQRDRVAGYITIGRQEGARVVTGGETLPLPP
ELAGGWFVPPTLLADVDNGMRVAQEEIFGPVVAVIAYDDVDDAVRIANDSVYGLSGSVWS
SDDGRAVEVARRVRTGMVSINGRPQAYGSPFGGYKQSGIGREMGPEGFAAFLETKSIAVG
L
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
ttgaccgatcggccggagctcttcatcggcggtacctggcaggcgccccggggcggtgag
gtgatcgaggtccgcaaccccgccacccgcgcgctcgtgggccgcgccgccctggcctca
ccggccgacgtggacgccgcggtcggcgccgcccgcacctcgttcgactccggcgtctgg
tcccgcgcgacccccgaggagcgcgcggccgtgctgcaccgggccgccgaccacctcgag
aagcgcgcggccgacctcgccgtcagcatcacctccgagctcggctgcccgctgtggttc
agcgagatggcccacgtgcccaacccgatccggcacacgcgctactacgccgaccacgcg
cggacgttcgcgtacgacgaggtgcgctccgacggccgcaacgccagcctggtcacccag
gagccggtgggcgtcgtcgccgcgatcaccccctggaacggcccgctcagcacgccctcg
ctcaagatcgcgccggccctcgccgcaggctgctcggtcgtgctcaagccgccgcccgag
acgccgctgacggcctacgccttcgccgacgcgctgctcgaggccggcctgcccgaaggc
gtcctcagcatcatcccgggcgaccgggaggccggcgcgcacctggtcgagcacgccgac
gtcgacaagatcgcgttcaccggcagcagcctggccggcaagcagatcatggccacggcc
gcgcagcgcgtcgcccgggtcaccctcgagctgggcggcaagtccgccgcgatcgtcctc
gacgacgccgacatctccgccgtcgtcccggcactgctgccgatggcgatgatggtcaac
ggccaggcgtgcatcgcgcagacccgggtcctggtgccgcgctcgcggcagaaggagctc
gtcgacgcgctcgccgatgccatggccgcgcagaaggtcggcgacccgatggccgccgac
accaagatcgggccgatggtcagcgagcgccagcgtgaccgggtcgccggctacatcacg
atcggccgccaggagggcgcccgcgtggtgaccggtggcgagaccctgccgctgccgccc
gagctggccggcggctggttcgtgccgccgacgctgctcgccgacgtcgacaacggcatg
cgggtggcccaggaggagatcttcgggcccgtcgtcgccgtcatcgcgtacgacgacgtc
gacgacgccgtccggatcgccaacgactccgtctacgggctctccggctcggtctggagc
tcggacgacggccgcgccgtcgaggtcgcgcgccgggtccggacgggcatggtcagcatc
aacggccgcccgcaggcctacggctcgccgttcggcggctacaagcagtcgggcatcggc
cgcgagatgggcccggagggcttcgcggccttcctcgagaccaagtcgatcgcggtcggg
ctgtga

DBGET integrated database retrieval system