KEGG   Pimelobacter simplex: KR76_27170Help
Entry
KR76_27170        CDS       T03528                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
psim  Pimelobacter simplex
Pathway
psim00473  D-Alanine metabolism
psim00550  Peptidoglycan biosynthesis
psim01100  Metabolic pathways
psim01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:psim00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    KR76_27170
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    KR76_27170
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    KR76_27170
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:psim01011]
    KR76_27170
Enzymes [BR:psim01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     KR76_27170
Peptidoglycan biosynthesis and degradation proteins [BR:psim01011]
 Precursor biosynthesis
  Amino acid ligase
   KR76_27170
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp ATP-grasp_3 CPSase_L_D2 ATP-grasp_4 RimK ATPgrasp_ST
Motif
Other DBs
NCBI-ProteinID: AIY19536
UniProt: A0A0A1DQ57
LinkDB All DBs
Position
complement(5540900..5541856)
Genome map
AA seq 318 aa AA seqDB search
MRTDLKTRTRVAVIGGGQNCEHDVSLASAASVAAALDPEHYEVVPLTIGRDGTWHDRGQR
PIGLSGAAQVLRGCDVVFPVVHGPRGEDGALAALCELAGLPYVGSGIRPGALAMDKWATK
LVAQAVGLATAPGRLVTRATAAHLAWSHPVVVKPVAAGSSQGVTLVDRPAALRPALDAAF
ALDDRVLVEDVVTGREIDVAVLRRPDGSLLVPPALEIVVDGLFDYDAKYGGHADFRIPAA
VEEADAKALEDAAVTAYEALGCAGVARIDFFLTDAGPVLNEVNTVPGMTEHSQAPRMFAA
AGLPYPDLLDELVRGAHR
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgaggaccgacctgaaaacccgcacccgggtcgccgtcatcggcggggggcagaactgc
gagcacgacgtctccctcgcctccgcggcgtcggtcgcggcggcgctcgaccccgagcac
tacgaggtggtcccgctgaccatcggccgcgacggcacctggcacgaccgcgggcagcgc
ccgatcgggctcagcggcgcggcgcaggtgctgcgcggctgcgacgtcgtcttccccgtc
gtgcacggaccccgcggcgaggacggcgccctggccgcgctgtgcgagctggccggactc
ccctatgtcggctccggcatccgccccggcgcgctcgccatggacaagtgggcgaccaag
ctcgtcgcccaggccgtcggcctcgccaccgcgcccggacggctcgtcacccgcgccacc
gccgcgcacctcgcgtggtcgcaccccgtcgtggtcaagcccgtcgccgccggctcgagc
cagggcgtcacgctcgtcgaccgccccgcggcgctgcggcccgcgctcgacgcggcgttc
gcgctcgacgaccgggtcctggtcgaggacgtcgtcaccggccgcgagatcgacgtcgcc
gtgctgcgccgtcccgacggcagcctgctcgtcccgcccgcgctggagatcgtcgtcgac
ggcctcttcgactacgacgccaagtacggcggccacgccgacttccggatccccgccgcc
gtcgaggaggcggacgccaaggcgctcgaggacgccgccgtcacggcgtacgaggcgctg
ggctgcgccggcgtggcccggatcgacttcttcctcaccgacgcaggccccgtcctcaac
gaggtcaacacggtgccggggatgacggagcactcgcaggcgccgcggatgttcgcggcg
gccggcctgccctacccggaccttctcgacgagctcgtccgcggcgcgcaccggtga

DBGET integrated database retrieval system