KEGG   Pimelobacter simplex: KR76_27620Help
Entry
KR76_27620        CDS       T03528                                 

Definition
(GenBank) aminotransferase
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
psim  Pimelobacter simplex
Pathway
psim00220  Arginine biosynthesis
psim00250  Alanine, aspartate and glutamate metabolism
psim00290  Valine, leucine and isoleucine biosynthesis
psim01100  Metabolic pathways
psim01110  Biosynthesis of secondary metabolites
psim01130  Biosynthesis of antibiotics
psim01210  2-Oxocarboxylic acid metabolism
psim01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:psim00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    KR76_27620
   00290 Valine, leucine and isoleucine biosynthesis
    KR76_27620
   00220 Arginine biosynthesis
    KR76_27620
Enzymes [BR:psim01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     KR76_27620
    2.6.1.66  valine---pyruvate transaminase
     KR76_27620
Amino acid related enzymes [BR:psim01007]
 Aminotransferase (transaminase)
  Class I
   KR76_27620
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Beta_elim_lyase Aminotran_5 Aminotran_MocR
Motif
Other DBs
NCBI-ProteinID: AIY19599
UniProt: A0A0A1DQH4
LinkDB All DBs
Position
5629066..5630280
Genome map
AA seq 404 aa AA seqDB search
MRKIRQSKKLRNVRYDVRGPILVEAQRLEAEGHKILKLNIGNPAPFGFEAPEAIVADMVH
NLPDAQGYSDSRGIYSARTAVAQYYQSRGLKDVAVEDVFIGNGVSEMISMVLQAFLDDGN
EILVPAPDYPLWTGAVSLSGGTPVHYRCDEENGWMPDLADIESKITENTHGIVIINPNNP
TGAVYSKEMVAALVDIARRHDLVVFSDEIYEKILFDDAVHHHAAQAAGSDVLCLTFSGLS
KAYRVCGYRAGWVMVSGPQELAEDFLEGLTTLSNMRMCANVPAQHAIQTALGGYQSINEL
IVPGGRFYEQAMLADKLLNEIPGVTSVRPRGALYCFPRLDPEMYPIDDDESFVIELLRAK
KILVTHGTGFNWFDTDHFRLVTLPDVDVLEEAIGRIADFLATRR
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
gtgcgcaagatccgccagagcaagaagctccgcaacgtccgctacgacgtccggggaccg
atcctcgtcgaggcccagcgcctcgaggcagagggtcacaagatcctcaagctcaacatc
ggcaatcccgcacccttcggcttcgaggcacccgaggcgatcgtcgccgacatggtgcac
aacctgcccgacgcccagggctactccgactcgcgcggcatctactcggcccgcaccgcc
gtggcgcagtactaccagtcgcgcggcctgaaggacgtcgccgtcgaggacgtcttcatc
ggcaacggcgtctccgagatgatctcgatggtgctccaggccttcctcgacgacggcaac
gagatcctcgtccccgcgccggactacccgctgtggacgggcgccgtctcgctgtccggc
ggcacccccgtgcactaccggtgcgacgaggagaacggctggatgccggacctcgctgac
atcgagtccaagatcaccgagaacacgcacggcatcgtcatcatcaaccccaacaacccc
acgggtgccgtctacagcaaggagatggtggccgcgctggtcgacatcgcccggcgccac
gacctcgtcgtcttctccgacgagatctacgagaagatcctcttcgacgacgcggtgcac
caccacgcggcccaggcggccggcagcgacgtcctctgcctcacgttcagcggcctgtcc
aaggcctaccgcgtctgcggctaccgggccggctgggtgatggtctccgggccgcaggag
ctcgccgaggacttcctcgagggcctcaccacgctctcgaacatgcgcatgtgcgccaac
gtccccgcgcagcacgccatccagaccgcgctcggcggctaccagtcgatcaacgagctg
atcgtgcccggcggccgcttctacgagcaggcgatgctcgccgacaagctgctcaacgag
atcccgggcgtcacctcggtgcgcccccgcggcgcgctctactgcttcccgcggctcgac
ccggagatgtaccccatcgacgacgacgagagcttcgtcatcgagctgctgcgcgccaag
aagatcctggtcacccacggcaccgggttcaactggttcgacaccgaccacttccggctg
gtgacgctgcccgacgtcgacgtcctcgaagaggccatcggccggatcgccgacttcctc
gccacccggcgctga

DBGET integrated database retrieval system