KEGG   Pseudorhodoplanes sinuspersici: CAK95_15865Help
Entry
CAK95_15865       CDS       T04834                                 

Definition
(GenBank) enoyl-[acyl-carrier-protein] reductase
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
psin  Pseudorhodoplanes sinuspersici
Pathway
psin00061  Fatty acid biosynthesis
psin00780  Biotin metabolism
psin01100  Metabolic pathways
psin01130  Biosynthesis of antibiotics
psin01212  Fatty acid metabolism
Module
psin_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:psin00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    CAK95_15865
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    CAK95_15865
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    CAK95_15865
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:psin01004]
    CAK95_15865
Enzymes [BR:psin01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     CAK95_15865
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     CAK95_15865
Lipid biosynthesis proteins [BR:psin01004]
 Fatty acid synthase
  Component type
   CAK95_15865
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR
Motif
Other DBs
NCBI-ProteinID: ARQ00389
UniProt: A0A1W6ZSJ9
LinkDB All DBs
Position
3273514..3274332
Genome map
AA seq 272 aa AA seqDB search
MPDAPGLMRGKRGLIMGVANNRSIAWGIAKACHNHGADLAFTYQGDALKKRVEPLAEEVD
GIVVGHCDVSEPATIDAAFQAVEAAWGSLDFVVHAIAFSDKDQLDGRYIDTTEDNFVKTM
LISCYSFTAIAQRAEKLMTNGGSMLTLTYYGAEKWMPHYNVMGLAKAALESSVRYLAADL
GQKNIRVNAISAGPIKTLAASGIGDFRYILKWNEYNTPLRRNVSLDEVGDSAAYFLSDLS
RGVTGEIHHVDAGYHVVGIKHPDAPDLTVGEP
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atgccggacgcacctggcctcatgcgcggaaaacgcgggctgatcatgggggtcgcgaat
aaccgttcgatcgcctggggtatcgccaaggcctgccacaatcatggggcggacctggcc
ttcacctaccagggcgacgcgctgaaaaagcgggtcgagccgctggccgaggaggtcgac
ggcatcgtggtcggccattgcgacgtgtccgaaccggccaccatcgatgcggcgtttcag
gcggtggaagcagcctggggttcgctcgattttgtggtgcacgccatcgccttctccgac
aaggatcaactcgacgggcgttatatcgatacgaccgaagacaacttcgtgaagacgatg
ttgatctcctgctattcgttcaccgcgatcgctcagcgggccgagaagctgatgacgaat
ggcggatcgatgctgacgctgacctattacggcgccgagaaatggatgccacattacaat
gtcatgggtctggcgaaggctgcgctcgaatcctcggtgcgttatctcgccgccgatctc
ggtcaaaagaacatccgcgtgaatgcgatctccgccggcccgatcaagacgctggctgcg
tcggggatcggcgatttccggtatatcctgaaatggaacgaatataatacaccgctgcgc
cgcaatgtttcgctcgatgaggtcggcgattccgccgcctatttcctgtcggatctttcg
cgcggcgtgaccggagagatccatcatgtcgatgccggttaccatgttgtcggcatcaag
catcctgatgcgccggatttgaccgtcggcgaaccctga

DBGET integrated database retrieval system