KEGG   Pseudorhodoplanes sinuspersici: CAK95_16990Help
Entry
CAK95_16990       CDS       T04834                                 

Definition
(GenBank) nitrate ABC transporter, permease protein
  KO
K15577  nitrate/nitrite transport system permease protein
Organism
psin  Pseudorhodoplanes sinuspersici
Pathway
psin00910  Nitrogen metabolism
psin02010  ABC transporters
Module
psin_M00438  Nitrate/nitrite transport system
psin_M00615  Nitrate assimilation
Brite
KEGG Orthology (KO) [BR:psin00001]
 Metabolism
  Energy metabolism
   00910 Nitrogen metabolism
    CAK95_16990
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    CAK95_16990
Transporters [BR:psin02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   Nitrate/nitrite transporter [MD:M00438] [OT]
    CAK95_16990
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1
Motif
Other DBs
NCBI-ProteinID: ARQ00582
UniProt: A0A1W6ZTA7
LinkDB All DBs
Position
3507831..3508727
Genome map
AA seq 298 aa AA seqDB search
MNMPVLKTEQSIKAAMPSAEVLRITPSKPNVVQTKLMPALRDLAATILPPLVMIVLLLTV
WQILCMKPGATLPSPTKIWSEAYDLIVDPFFVAGPQDIGLGWRVLISLQRVAIGYGFAAV
IGIMLGTIIGQSVWAMRGLDPIFQVLRTISPLAWLPISLAAFRDSQPSAIFVIFITSVWP
IIINTAVGIRNIPQDYRNVARVLRLNHLEFFWKIMIPSAAPYIFTGLRIGIGLSWLAIVA
AEMLTGGVGIGFFIWDAWNSSRLSDIVVALIYIGVVGFVLDRIVAFIATIVTRGTSAN
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgaacatgcctgtcctcaagaccgagcaaagcatcaaggcggcgatgccgagcgcggag
gttttgcgcatcacgccgtccaagccgaatgtcgtgcagaccaaactgatgcctgcgctc
cgcgatctcgccgcgacgatcttgccgccgctggtgatgatcgtcctgctcctcacggtc
tggcaaatcctgtgcatgaagccgggcgcaacgcttccatcgccgacgaagatctggagc
gaagcctacgatctgatcgtcgatccgttctttgtggccggcccgcaggacatcggtctt
ggctggcgcgtgctgatatcgctgcagcgtgttgccatcggttacggctttgccgccgtg
atcggcatcatgctcggcaccatcatcggacagtcggtctgggcgatgcgcgggctcgat
ccgatcttccaggtgctgcgcacgatctcgccgctggcctggctgccgatctcgctggcg
gcgtttcgcgatagccaaccgtcggcgattttcgtgatctttatcacctcggtctggccg
atcatcatcaacaccgcggtcggcatccgcaatattccgcaagactatcgcaatgtcgcg
cgggtgctgcggctgaaccatctcgaattcttctggaagatcatgatcccgtcggcggcg
ccctacatcttcacgggcctgcgcatcggcatcggtctgtcatggcttgccatcgtcgcg
gcggaaatgctgaccggcggcgtgggcatcggcttcttcatctgggatgcctggaattcg
tcgcgcctgtccgacatcgtcgtcgcactcatttacatcggcgtcgtcggcttcgttctc
gaccgcatcgttgcctttatcgcaaccatcgtcacccgcggcacgtcagccaactaa

DBGET integrated database retrieval system