KEGG   Pseudorhodoplanes sinuspersici: CAK95_17470Help
Entry
CAK95_17470       CDS       T04834                                 

Definition
(GenBank) glutathione transferase GstA
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
psin  Pseudorhodoplanes sinuspersici
Pathway
psin00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:psin00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    CAK95_17470
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:psin02000]
    CAK95_17470
Enzymes [BR:psin01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     CAK95_17470
Transporters [BR:psin02000]
 Other Transporters
  Pores ion channels [TC:1]
   CAK95_17470
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_C GST_C_3 GST_N GST_C_2 GST_N_2 GST_N_3 GST_C_6 Tom37
Motif
Other DBs
NCBI-ProteinID: ARQ00669
UniProt: A0A1W6ZTD5
LinkDB All DBs
Position
3601779..3602396
Genome map
AA seq 205 aa AA seqDB search
MKLYYSPGACSLSPHIVFREAGLPVEIERVDNRAKKTASGDDFLSVNPLGMVPVLKLDNG
ETLTEGPAIVQYLADMKPESGLMPKPGSMERYRVLEWLNYITSELHKQFTPLFKPDTPDG
YKTIAKENVIKAFDRINAHLAGKPYLMGDTFTVADAYLFVVSNWARFHNIDVAQWPNLKA
FQDRVKARPAVHEAMKAEGLIKAAA
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgaagctttattattcgccgggtgcctgttcgctgtctccccacatcgtcttccgcgag
gccggtctgccggtcgagatcgaacgggtcgacaacagggccaagaagacagccagtggc
gacgacttcctgtcggtcaatccgctcggcatggtgccggtgctcaaactcgacaatggc
gagacgctgacggagggcccggcaatcgtgcagtatcttgccgacatgaagcccgagtca
ggcttgatgccgaagccaggttcgatggagcgctatcgcgtgctcgagtggttgaattac
atcacgtccgaactgcacaagcagttcacgccgctgttcaagccggacacgccggacgga
tacaagacgattgccaaggagaatgtgatcaaggcgttcgatcgcatcaatgcgcacctc
gctggcaagccatatctgatgggggacacttttacggttgccgacgcttatctgttcgtc
gtcagcaactgggcgcgcttccacaatatcgatgtcgcgcaatggccaaacctgaaggcg
ttccaggaccgcgtgaaggcgcgtccggccgtgcatgaggcaatgaaggccgaggggttg
atcaaggccgcggcttga

DBGET integrated database retrieval system