KEGG   Pseudorhodoplanes sinuspersici: CAK95_21225Help
Entry
CAK95_21225       CDS       T04834                                 

Definition
(GenBank) elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
psin  Pseudorhodoplanes sinuspersici
Brite
KEGG Orthology (KO) [BR:psin00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:psin03012]
    CAK95_21225
   03029 Mitochondrial biogenesis [BR:psin03029]
    CAK95_21225
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:psin04147]
    CAK95_21225
Translation factors [BR:psin03012]
 Eukaryotic Type
  Elongation factors
   CAK95_21225
 Prokaryotic Type
   CAK95_21225
Mitochondrial biogenesis [BR:psin03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    CAK95_21225
Exosome [BR:psin04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   CAK95_21225
  Exosomal proteins of breast cancer cells
   CAK95_21225
  Exosomal proteins of colorectal cancer cells
   CAK95_21225
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 cobW RsgA_GTPase
Motif
Other DBs
NCBI-ProteinID: ARQ01336
UniProt: A0A1W6ZVJ9
LinkDB All DBs
Position
4388294..4389484
Genome map
AA seq 396 aa AA seqDB search
MAKEKFNRSKPHCNIGTIGHVDHGKTSLTAAITKVLAESGGASFTAYDQIDKAPEEKARG
ITISTAHVEYETPNRHYAHVDCPGHADYVKNMITGAAQMDGAILVVSAADGPMPQTREHI
LLARQVGVPALVVFLNKVDMVDDPELLELVELEVRELLSKYNFPGDTIPIIKGSALCALE
DKDPKLGHDAVLELMKAVDDYIPQPERPIDQPFLMPVEDVFSISGRGTVCTGRVERGIVK
VGEEVEIVGLKPTLKTTVTGVEMFRKLLDQGQAGDNIGALLRGTKREEVERGQVLCKPGS
VKPHTKFKAEAYILTKEEGGRHTPFFTNYRPQFYFRTTDVTGIVHLPEGTEMVMPGDNIA
MEVHLIVPIAMEEKLRFAIREGGRTVGAGVVASIIE
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atggctaaagagaaattcaaccgcagcaagccgcactgcaatatcggcaccatcggtcac
gtcgaccatggcaagacgtcgttgacggctgcgatcacgaaggttctggcggagtcgggc
ggtgcgtccttcacggcctatgaccagatcgacaaggcgccggaagagaaggcgcgcggc
atcaccatctcgaccgctcacgtcgagtatgagacgccgaaccgtcactatgcgcacgtc
gactgccctggccacgccgactacgtgaagaacatgatcaccggtgcggcgcagatggac
ggcgcgatcctcgtcgtgtcggctgctgacggcccgatgccgcagacccgcgagcacatc
ctgctcgcccgccaggtcggcgtgccggcgctcgtcgtgttcctgaacaaggtcgacatg
gtcgacgatccggagctgctcgagctcgtcgaactcgaagtgcgcgagcttctctccaag
tacaatttcccgggcgacacgatcccgatcatcaagggctcggctctctgcgctctcgaa
gacaaggatccgaagctcggccatgacgctgtgcttgagctgatgaaggcggtggacgat
tacattccgcagccggagcgtccgatcgatcagccgttcctgatgccggttgaagacgtg
ttctcgatctcgggccgcggcactgtgtgcaccggtcgcgtcgagcgcggcatcgtgaag
gtcggtgaggaagtcgagatcgtcggtctgaagccgacgctgaagacgactgttaccggc
gttgaaatgttccgcaagctgctcgatcagggccaggcgggcgacaacatcggcgcgctg
ctgcgcggcaccaagcgcgaggaagtcgagcgcggccaggtgctctgcaagccgggctcg
gtgaagccgcacacgaagttcaaggccgaagcctacatcctcaccaaggaagagggtggc
cgccacacgccgttcttcaccaactaccgtccgcaattctatttccgcacgaccgacgtg
accggcatcgtgcatctgccggaaggcacggaaatggtgatgccgggcgacaacatcgcg
atggaagtgcacctgatcgtgccgatcgcgatggaagagaagctccgcttcgctatccgc
gaaggtggccgcaccgtcggcgccggcgtggttgcaagcatcatcgagtaa

DBGET integrated database retrieval system