KEGG   Pseudorhodoplanes sinuspersici: CAK95_24870Help
Entry
CAK95_24870       CDS       T04834                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
psin  Pseudorhodoplanes sinuspersici
Pathway
psin00473  D-Alanine metabolism
psin00550  Peptidoglycan biosynthesis
psin01100  Metabolic pathways
psin01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:psin00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    CAK95_24870
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    CAK95_24870
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    CAK95_24870
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:psin01011]
    CAK95_24870
Enzymes [BR:psin01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     CAK95_24870
Peptidoglycan biosynthesis and degradation proteins [BR:psin01011]
 Precursor biosynthesis
  Amino acid ligase
   CAK95_24870
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C ATP-grasp_3 Dala_Dala_lig_N B12-binding DUF4071 ATPgrasp_Ter
Motif
Other DBs
NCBI-ProteinID: ARQ01972
UniProt: A0A1W6ZX58
LinkDB All DBs
Position
5101435..5102451
Genome map
AA seq 338 aa AA seqDB search
MKKTRVLVLLHPEQAPPDSIKGYSEQDILAFKTGYDVVNTLRKARHEVRVLGVQYELRPI
RQEIEDFKPDIVFNLLEEFHGEPAYDQNVASYLELLRIPYTGCNPRGLILSRGKDLSKKL
VHYHRIPTPAFAVFPMNRRIKRPDRLPFPLIVKSLSEDASLGIAQKSIVDNDDRLEERVT
FIHEKIGTAAIAEQYIDGRELYVSVLGNERLRLFPIWELEFGDIGSRIATAKVKFDVKYQ
EERGILQGAAVDLAPDIEKRIYSLTRRICRTLELDGYARVDFRLAADGTPYFLEANPNPE
IARHEVFAEAAEYGGMKYSDMLRRIVQLGLQRSRKMQR
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaacgcgcgttctggttcttttgcatccagagcaggcgccgccggactcgatc
aaaggatacagcgagcaggatatactcgcgttcaagaccggctacgacgtcgtcaataca
ttgcgaaaggcgcggcacgaagttcgtgtcctcggcgtgcaatatgaattgcggccgatc
cggcaagaaatcgaagatttcaaacccgacatcgtcttcaacttgctggaggaatttcac
ggcgagccggcctacgaccagaatgtcgcaagctatctcgaattgctccgcatcccctat
accggctgcaatccgcgtggattgattttgtcacgcggcaaggatctgtcgaagaaactc
gttcactatcatcgcattccgacaccagccttcgccgtcttcccgatgaaccggagaatc
aagcggcctgaccgtctgccttttccgctgattgtcaaaagcctgagcgaggatgcgtcg
cttggcattgcgcagaaatccatcgtcgataacgacgacaggctggaggagcgcgtcacc
ttcattcacgaaaagatcggcaccgctgcgattgccgagcaatatatcgacggccgcgaa
ctttatgtcagcgtgctcggcaacgaacggctgcgccttttcccgatctgggagcttgaa
ttcggcgatatcggcagccgcattgcaaccgccaaagtgaaattcgatgtcaaatatcag
gaagagcgcggcatcctgcagggcgccgctgtcgatcttgcgccggacattgaaaagcgc
atttacagcctgacacgccgcatttgccgcaccctcgaactcgacggttacgcgcgcgtc
gattttcggctcgcggccgatggcacgccgtattttctcgaggctaaccccaacccggaa
atcgcccgccatgaagtgttcgcggaagcggctgaatatggcggcatgaagtattccgat
atgctgcgccggatcgtccagcttggcctgcagcgcagccggaagatgcagcgctag

DBGET integrated database retrieval system