KEGG   Pseudorhodoplanes sinuspersici: CAK95_26700Help
Entry
CAK95_26700       CDS       T04834                                 

Definition
(GenBank) succinate dehydrogenase
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
psin  Pseudorhodoplanes sinuspersici
Pathway
psin00020  Citrate cycle (TCA cycle)
psin00190  Oxidative phosphorylation
psin00650  Butanoate metabolism
psin01100  Metabolic pathways
psin01110  Biosynthesis of secondary metabolites
psin01120  Microbial metabolism in diverse environments
psin01130  Biosynthesis of antibiotics
psin01200  Carbon metabolism
Module
psin_M00009  Citrate cycle (TCA cycle, Krebs cycle)
psin_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
psin_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:psin00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CAK95_26700
   00650 Butanoate metabolism
    CAK95_26700
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    CAK95_26700
Enzymes [BR:psin01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     CAK95_26700
    1.3.5.4  fumarate reductase (quinol)
     CAK95_26700
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2
Motif
Other DBs
NCBI-ProteinID: ARQ03222
UniProt: A0A1W7A0U0
LinkDB All DBs
Position
complement(5488364..5490007)
Genome map
AA seq 547 aa AA seqDB search
MAAALSAAEMGAEVILADRSLIGRSGATIMAQMTVAVALGSETPDHWEHHLADTLTAGRG
LCDANLAALVCEQGPAAIQQLDEWRVGWARKADGGIRQTQAPGHDRPRCVYVDFLATGPA
VAKTLRGRVLRQKLVTRIGDLYLTDLALVDGAVAGAIGFSVADGQPVSIAAKTVILATGG
LTRLYRRNSASANMGGDGHALALRAGAELMDMEFVQFFPIGHLAPRLVGMDPIMWDPFRY
KLGGRLLNSEMREFMNDYGNEEGGRYVVTRDKATHAILKEVEAGRGSPAGGAFLSFQHIP
GDKLREAFGPVIDRLAANGIDLSKMPVEVAPIAHYHMGGVKTDTTMETRVPNLYAAGELV
AGANGANRLSGNAITEALVFGRIAGEAAAMRANTIAHHSWKNALATEQLEIASASTPRPD
LNLAGVIAELQAVMADFVGPFRTREGLEHALASLADMKSAIGTIAPETKGPYNLERIDWF
DLRSMLLVAETITRAALLRTESRGAHQRNDFPGLDDNWALHQTVALHQNELVFGRAPVVG
SRVSEVA
NT seq 1644 nt NT seq  +upstreamnt  +downstreamnt
atggcggcagctctgtcggctgctgaaatgggtgccgaggttattctggccgaccgcagc
ctgatcggccgcagtggcgcgaccattatggcgcagatgacggtcgcggtagcattgggc
tccgaaacgcccgatcattgggagcaccatcttgcggatacgctgactgcgggacgcggt
ctgtgcgatgcgaatctcgccgcactggtttgcgaacaggggcccgcggctattcagcag
cttgacgagtggcgggtcggctgggcccgcaaggccgacggcggcatacgccagacacag
gcgccgggacatgatcggccgcgctgcgtttatgtcgattttctggcaacgggaccggcg
gttgcgaagacgttacgcggccgtgttcttcggcagaagctcgtgactcggattggcgat
ctttatctgacggatctggcgctcgtcgatggggctgtagcgggtgcgatcggcttttcg
gtcgccgacggccaaccggtttccattgcagccaagacggtgattctggcgaccggtgga
ttgacgcgtctctatcggcgtaacagtgcctccgcgaatatgggcggagatggccatgct
ttggctttacgcgccggtgccgagctcatggacatggaattcgtgcagttttttcccatc
ggccatctcgcgccacgtctggtcggcatggatccgatcatgtgggatccattccgttac
aagttgggcggacgcctgctgaattccgaaatgcgtgagttcatgaacgactatgggaac
gaggagggcggccgatatgtcgtgacgcgcgacaaggcaacgcatgcgattctcaaagaa
gtcgaggctgggcgcggctcgccggcgggtggcgcgtttctcagcttccagcatattccg
ggcgacaagcttcgcgaagcattcgggcccgtgatcgatcgcctcgctgccaacggcatc
gacctgtcaaaaatgccagtcgaggtggcgccgattgcgcattaccatatgggtggcgtg
aagaccgacacgaccatggaaacacgggtgcccaatctctatgccgctggagagcttgtc
gccggggccaatggcgcaaatcggctctccggtaatgcgatcacggaggcgctggttttt
gggcgaatagccggcgaagcggccgctatgagggccaacacgatcgcgcatcacagttgg
aaaaacgctttggccactgaacaactggagatagcatctgcatcaactccacggcccgat
ctgaatttggcgggtgttattgcagagttgcaggccgtcatggccgactttgtcggtccc
tttcgtacacgcgagggtctggagcatgcgcttgcgagtttggctgacatgaagagcgcc
atcggtacgatagcgccggaaacaaaaggtccctataacctggaacgtatcgattggttc
gacctgcgctcgatgttgctcgtggcagaaacgatcacgcgcgcggcgctcttgcgcacc
gagagccgcggtgctcatcaaagaaatgatttcccgggcctcgacgataattgggctttg
catcagacagtcgcgttgcatcagaatgaattggtgtttgggcgcgcaccggtcgttgga
agccgagtttcggaggtcgcttga

DBGET integrated database retrieval system