KEGG   Pseudomonas stutzeri DSM 10701: PSJM300_00130Help
Entry
PSJM300_00130     CDS       T02182                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
psj  Pseudomonas stutzeri DSM 10701
Brite
KEGG Orthology (KO) [BR:psj00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    PSJM300_00130
Enzymes [BR:psj01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     PSJM300_00130
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 HI0933_like FAD_binding_2 AlaDh_PNT_C FAD_oxidored DAO FAD_binding_3 Glutaredoxin K_oxygenase Thi4 FMO-like NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: AFN76110
LinkDB All DBs
Position
30028..31590
Genome map
AA seq 520 aa AA seqDB search
MLDSNLKTQLKAYLEKVTQPFEIVASLDDGEKSQEMLSLLQDIASLSDKITLKTDGQDAR
KPSFSLNRIGGDIGLRFAGLPMGHEFTSLVLALLQVGGHPSKTAPEVIEQIKNIEGEYHF
ETYFSLSCQNCPDVVQALNLMAVLNPAIRHVAIDGALFQDEVEARQVMSVPSIYLNGELF
GQGRMGEEEILAKLDTGAAARDAEKLNAKDAFDVLVIGGGPAGAAAAIYAARKGIRTGVA
AERFGGQVLDTMAIENFISVKETEGPKLARALEEHVREYDVDIMNLQRAAALIPAGADGL
HEVKMDSGASLKARTLILATGARWREMNVPGEQEYRGRGVAYCPHCDGPLFKGKRVAVIG
GGNSGVEAAIDLAGIVAHVTLLEFGEELRADAVLQRKLQSLANVTILKMAQTTEVKGDGQ
KVTGLVYKDRTSEALHEVELEGIFVQIGLLPNSDWLKGTVELSRFGEIIVDAKGQTNIPG
VFAAGDVTTVPYKQIVIAVGEGAKASLSAFDHLIRTSVPA
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atgttggattccaatctcaagacccagttgaaggcctacctggaaaaggtcacccagccg
ttcgagatcgtcgcgtcccttgatgacggcgaaaaatcccaggaaatgctgagcctgctg
caggacatcgccagcctcagcgacaagatcaccctcaagaccgacggccaggacgcccgc
aagccgtcgttctcgctcaaccgcatcggcggcgatatcggcctgcgcttcgccggcctg
cccatgggccacgaattcacctcgctggtgctggccctgctgcaggtcggtggtcacccg
tccaagaccgcgccggaggtcatcgagcagatcaagaacatcgaaggcgaataccacttc
gagacctacttctcgctgtcctgccagaactgcccggacgtggtccaggcgctgaacctg
atggccgtgctcaaccccgccatccgccacgtcgccatcgacggcgcgctgttccaggac
gaggtcgaagcccgccaggtcatgtccgtgccgagcatctacctcaacggcgaactgttc
ggccagggccgcatgggcgaagaggaaatcctcgccaagctcgacaccggcgccgccgcc
cgcgacgccgagaaactcaacgccaaggacgccttcgacgtgctggtgatcggcggtggc
ccggccggcgccgcggcggccatctatgctgcgcgcaagggcatccgcaccggcgtggcg
gccgagcgcttcggcggccaggtgctggacaccatggccatcgagaacttcatctcggtg
aaggaaaccgaaggcccgaaactggcccgcgcgctggaagaacacgtgcgcgagtacgac
gtcgacatcatgaacctgcagcgcgccgccgcgctgatcccggccggtgccgacggcctg
cacgaagtgaagatggacagcggtgcctcgctcaaggcgcggaccctgatcctcgccacc
ggcgcgcgctggcgcgaaatgaacgtacccggcgagcaggaataccgcggccgtggcgtc
gcctactgcccgcactgcgacggcccgctgttcaagggcaagcgcgtggcggtgattggc
ggcggcaactccggggtggaagcggcgatcgacctggccggcatcgtcgcccacgtcacc
ctgctggaattcggtgaagaactgcgcgccgacgccgtgctgcagcgcaagctgcagagc
ctggccaacgtcaccatcctcaagatggcgcagaccaccgaggtcaagggcgacggtcag
aaagtcaccgggctggtctacaaggaccgcaccagcgaagcgctgcacgaggtcgagctg
gaaggcattttcgtgcagatcggcctgctgcccaacagcgactggctgaaaggcaccgtc
gagctgtcgcgcttcggcgagatcatcgtcgacgccaagggccagaccaacatccccggc
gtgttcgcggccggcgacgtgaccacggtgccctacaagcagatcgtcatcgccgtgggc
gaaggcgccaaggcctcgctgagtgccttcgaccacttgatccggacgtccgtaccggcg
taa

DBGET integrated database retrieval system